The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
22
|
sequence length |
151
|
structure length |
151
|
Chain Sequence |
TGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIHQRGGQTINGTLRINNTLTIASGGANITGTVNMTGGYIQGKRVVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGSSSNPGLPDMR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of a Heat- and Protease-Stable Part of the Bacteriophage T4 Short Tail Fibre
pubmed doi rcsb |
molecule tags |
Structural protein
|
source organism |
Bacteriophage t4
|
molecule keywords |
BACTERIOPHAGE T4 SHORT TAIL FIBRE
|
total genus |
22
|
structure length |
151
|
sequence length |
151
|
ec nomenclature | |
pdb deposition date | 2001-06-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09089 | gp12-short_mid | Phage short tail fibre protein gp12, middle domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 1 | heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 1 | ||
Mainly Beta | 3 Solenoid | heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 2 | heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 2 | ||
Alpha Beta | Alpha-Beta Complex | heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3 | Phage tail collar domain |
#chains in the Genus database with same CATH superfamily 1H6W A; 2XGF A; 1OCY A; #chains in the Genus database with same CATH topology 1H6W A; 2XGF A; 1OCY A; #chains in the Genus database with same CATH homology 1H6W A; 2XGF A; 1OCY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...