1HUEA

Histone-like protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
90
Chain Sequence
MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEMEIPASKVPAFKPGKALKDAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna-binding
molecule keywords HU PROTEIN
publication title Solution structure of the HU protein from Bacillus stearothermophilus.
pubmed doi rcsb
total genus 14
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00216 Bac_DNA_binding Bacterial DNA-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.520.10 Few Secondary Structures Irregular HU Protein; Chain A IHF-like DNA-binding proteins 1hueA00
4YEWA 4YEWC 5EKAA 4P3VA 1B8ZA 1OUZA 4YEXA 1OWGA 4N1VA 1IHFA 4FMRA 1P78A 1P71A 2NP2A 4YFTA 4YFTC 2O97B 1MULA 1OWFA 3RHIA 1OUZB 4QJNA 4YEYA 1P51A 1OWGB 1IHFB 1EXEA 5FBMA 1RIYA 5L8ZA 2IIFA 2HT0A 4PT4A 2O97A 2IIEA 1HUEA 1WTUA 4YF0A 1OWFB 4YFHA 1HUUA 2HT0B 4DKYA 2NDPA 4QJUA
chains in the Genus database with same CATH superfamily
4YEWA 4YEWC 5EKAA 4P3VA 1B8ZA 1OUZA 4YEXA 1OWGA 4N1VA 1IHFA 4FMRA 1P78A 1P71A 2NP2A 4YFTA 4YFTC 2O97B 1MULA 1OWFA 3RHIA 1OUZB 4QJNA 4YEYA 1P51A 1OWGB 1IHFB 1EXEA 5FBMA 1RIYA 5L8ZA 2IIFA 2HT0A 4PT4A 2O97A 2IIEA 1HUEA 1WTUA 4YF0A 1OWFB 4YFHA 1HUUA 2HT0B 4DKYA 2NDPA 4QJUA
chains in the Genus database with same CATH topology
4YEWA 4YEWC 5EKAA 4P3VA 1B8ZA 1OUZA 4YEXA 1OWGA 4N1VA 1IHFA 4FMRA 1P78A 1P71A 2NP2A 4YFTA 4YFTC 2O97B 1MULA 1OWFA 3RHIA 1OUZB 4QJNA 4YEYA 1P51A 1OWGB 1IHFB 1EXEA 5FBMA 1RIYA 5L8ZA 2IIFA 2HT0A 4PT4A 2O97A 2IIEA 1HUEA 1WTUA 4YF0A 1OWFB 4YFHA 1HUUA 2HT0B 4DKYA 2NDPA 4QJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEW A;  4YEW C;  5EKA A;  4P3V A;  1B8Z A;  1OUZ A;  4YEX A;  1OWG A;  4N1V A;  1IHF A;  4FMR A;  1P78 A;  1P71 A;  2NP2 A;  4YFT A;  4YFT C;  2O97 B;  1MUL A;  1OWF A;  3RHI A;  1OUZ B;  4QJN A;  4YEY A;  1P51 A;  1OWG B;  1IHF B;  1EXE A;  5FBM A;  1RIY A;  5L8Z A;  2IIF A;  2HT0 A;  4PT4 A;  2O97 A;  2IIE A;  1HUE A;  1WTU A;  4YF0 A;  1OWF B;  4YFH A;  1HUU A;  2HT0 B;  4DKY A;  2NDP A;  4QJU A; 
#chains in the Genus database with same CATH topology
 4YEW A;  4YEW C;  5EKA A;  4P3V A;  1B8Z A;  1OUZ A;  4YEX A;  1OWG A;  4N1V A;  1IHF A;  4FMR A;  1P78 A;  1P71 A;  2NP2 A;  4YFT A;  4YFT C;  2O97 B;  1MUL A;  1OWF A;  3RHI A;  1OUZ B;  4QJN A;  4YEY A;  1P51 A;  1OWG B;  1IHF B;  1EXE A;  5FBM A;  1RIY A;  5L8Z A;  2IIF A;  2HT0 A;  4PT4 A;  2O97 A;  2IIE A;  1HUE A;  1WTU A;  4YF0 A;  1OWF B;  4YFH A;  1HUU A;  2HT0 B;  4DKY A;  2NDP A;  4QJU A; 
#chains in the Genus database with same CATH homology
 4YEW A;  4YEW C;  5EKA A;  4P3V A;  1B8Z A;  1OUZ A;  4YEX A;  1OWG A;  4N1V A;  1IHF A;  4FMR A;  1P78 A;  1P71 A;  2NP2 A;  4YFT A;  4YFT C;  2O97 B;  1MUL A;  1OWF A;  3RHI A;  1OUZ B;  4QJN A;  4YEY A;  1P51 A;  1OWG B;  1IHF B;  1EXE A;  5FBM A;  1RIY A;  5L8Z A;  2IIF A;  2HT0 A;  4PT4 A;  2O97 A;  2IIE A;  1HUE A;  1WTU A;  4YF0 A;  1OWF B;  4YFH A;  1HUU A;  2HT0 B;  4DKY A;  2NDP A;  4QJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...