1HY9A

Cocaine and amphetamine regulated transcript
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
41
structure length
41
Chain Sequence
YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords COCAINE AND AMPHETAMINE REGULATED TRANSCRIPT PROTEIN
publication title Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.40.30 Few Secondary Structures Irregular Omega-AgatoxinV CART, C-terminal domain 1hy9A00
1HY9A
chains in the Genus database with same CATH superfamily
1XI7A 1H59B 1VTXA 1OAVA 1IVAA 1QDPA 2DCVA 1OAWA 1HY9A 1BOEA 1XJ1A 1OMAA 1CIXA 2DCWA 1AGGA 1G9PA 2ROOA
chains in the Genus database with same CATH topology
1HY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HY9 A; 
#chains in the Genus database with same CATH topology
 1XI7 A;  1H59 B;  1VTX A;  1OAV A;  1IVA A;  1QDP A;  2DCV A;  1OAW A;  1HY9 A;  1BOE A;  1XJ1 A;  1OMA A;  1CIX A;  2DCW A;  1AGG A;  1G9P A;  2ROO A; 
#chains in the Genus database with same CATH homology
 1HY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...