1HYKA

Agouti-related protein (87-132) (ac-agrp(87-132))
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
46
structure length
46
Chain Sequence
CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords AGOUTI RELATED PROTEIN
publication title NMR structure of a minimized human agouti related protein prepared by total chemical synthesis.
pubmed doi rcsb
total genus 4
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.760.10 Few Secondary Structures Irregular Agouti Related Protein; Chain A Agouti domain 1hykA00
1HYKA 1Y7JA 2KZAA 1Y7KA
chains in the Genus database with same CATH superfamily
1HYKA 1Y7JA 2KZAA 1Y7KA
chains in the Genus database with same CATH topology
1HYKA 1Y7JA 2KZAA 1Y7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYK A;  1Y7J A;  2KZA A;  1Y7K A; 
#chains in the Genus database with same CATH topology
 1HYK A;  1Y7J A;  2KZA A;  1Y7K A; 
#chains in the Genus database with same CATH homology
 1HYK A;  1Y7J A;  2KZA A;  1Y7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...