The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
75
|
structure length |
75
|
Chain Sequence |
YGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Major histocompatibility complex
|
molecule keywords |
PROTEIN (HLA-DR ANTIGENS ASSOCIATED INVARIANT CHAIN)
|
publication title |
Structure of a trimeric domain of the MHC class II-associated chaperonin and targeting protein Ii.
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
17
|
structure length |
75
|
sequence length |
75
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 1999-02-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08831 | MHCassoc_trimer | Class II MHC-associated invariant chain trimerisation domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | HLA-dr Antigens Associated Invariant Chain; Chain A | MHC class II-associated invariant chain, trimerisation domain |
#chains in the Genus database with same CATH superfamily 1IIE A; #chains in the Genus database with same CATH topology 1IIE A; #chains in the Genus database with same CATH homology 1IIE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...