1IVAA

Structure-activity relationships for p-type calcium channel selective omega-agatoxins
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
48
structure length
48
Chain Sequence
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords OMEGA-AGATOXIN-IVA
publication title Structure-activity relationships for P-type calcium channel-selective omega-agatoxins.
pubmed doi rcsb
source organism Agelenopsis aperta
total genus 3
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02819 Toxin_9 Spider toxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.40.10 Few Secondary Structures Irregular Omega-AgatoxinV Omega-AgatoxinV 1ivaA00
1OAVA 1OAWA 1QDPA 1OMAA 2ROOA 1VTXA 1IVAA 1G9PA 1AGGA
chains in the Genus database with same CATH superfamily
1OAVA 1OAWA 1QDPA 1H59B 1OMAA 2DCVA 2ROOA 1XI7A 1VTXA 1CIXA 1IVAA 1BOEA 1G9PA 2DCWA 1HY9A 1AGGA 1XJ1A
chains in the Genus database with same CATH topology
1OAVA 1OAWA 1QDPA 1H59B 1OMAA 2DCVA 2ROOA 1XI7A 1VTXA 1CIXA 1IVAA 1BOEA 1G9PA 2DCWA 1AGGA 1XJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OAV A;  1OAW A;  1QDP A;  1OMA A;  2ROO A;  1VTX A;  1IVA A;  1G9P A;  1AGG A; 
#chains in the Genus database with same CATH topology
 1OAV A;  1OAW A;  1QDP A;  1H59 B;  1OMA A;  2DCV A;  2ROO A;  1XI7 A;  1VTX A;  1CIX A;  1IVA A;  1BOE A;  1G9P A;  2DCW A;  1HY9 A;  1AGG A;  1XJ1 A; 
#chains in the Genus database with same CATH homology
 1OAV A;  1OAW A;  1QDP A;  1H59 B;  1OMA A;  2DCV A;  2ROO A;  1XI7 A;  1VTX A;  1CIX A;  1IVA A;  1BOE A;  1G9P A;  2DCW A;  1AGG A;  1XJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...