1JFWA

Homonuclear and heteronuclear 1h-13c nuclear magnetic resonance assignment and structural characterization of a hiv-1 tat protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
86
structure length
86
Chain Sequence
MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords TAT PROTEIN
publication title 1H-13C nuclear magnetic resonance assignment and structural characterization of HIV-1 Tat protein.
pubmed doi rcsb
total genus 16
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00539 Tat Transactivating regulatory protein (Tat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.20.10 Few Secondary Structures Irregular HIV-1 Transactivator Protein Tat domain 1jfwA00
1TIVA 1K5KA 1TACA 1TBCA 1JFWA
chains in the Genus database with same CATH superfamily
1TIVA 1K5KA 1TACA 1TBCA 1JFWA
chains in the Genus database with same CATH topology
1TIVA 1K5KA 1TACA 1TBCA 1JFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIV A;  1K5K A;  1TAC A;  1TBC A;  1JFW A; 
#chains in the Genus database with same CATH topology
 1TIV A;  1K5K A;  1TAC A;  1TBC A;  1JFW A; 
#chains in the Genus database with same CATH homology
 1TIV A;  1K5K A;  1TAC A;  1TBC A;  1JFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...