1JO6A

Solution structure of the cytoplasmic n-terminus of the bk beta-subunit kcnmb2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
45
structure length
45
Chain Sequence
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport, membrane protein
molecule keywords potassium large conductance calcium-activated channel, subfa
publication title NMR structure of the "ball-and-chain" domain of KCNMB2, the beta 2-subunit of large conductance Ca2+- and voltage-activated potassium channels.
pubmed doi rcsb
total genus 4
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09303 KcnmB2_inactiv KCNMB2, ball and chain domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.81.20 Few Secondary Structures Irregular Cytochrome C Oxidase; Chain M KCNMB2, ball/chain domain 1jo6A00
1JO6A
chains in the Genus database with same CATH superfamily
3ASOM 1OCOM 2DYRM 3ABKM 3AG2M 3ASNM 5B3SM 2EIKM 1V54M 3AG4M 3AG1M 2ZXWM 5IY5M 3WG7M 1V55M 5B1AM 2DYSM 1OCCM 2EIJM 2EIMM 1OCRM 3AG3M 2EILM 3X2QM 3ABLM 1JO6A 1OCZM 2EINM 5B1BM 2Y69M 3ABMM 2OCCM
chains in the Genus database with same CATH topology
1JO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JO6 A; 
#chains in the Genus database with same CATH topology
 3ASO M;  1OCO M;  2DYR M;  3ABK M;  3AG2 M;  3ASN M;  5B3S M;  2EIK M;  1V54 M;  3AG4 M;  3AG1 M;  2ZXW M;  5IY5 M;  3WG7 M;  1V55 M;  5B1A M;  2DYS M;  1OCC M;  2EIJ M;  2EIM M;  1OCR M;  3AG3 M;  2EIL M;  3X2Q M;  3ABL M;  1JO6 A;  1OCZ M;  2EIN M;  5B1B M;  2Y69 M;  3ABM M;  2OCC M; 
#chains in the Genus database with same CATH homology
 1JO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...