1JW3A

Solution structure of methanobacterium thermoautotrophicum protein 1598. ontario centre for structural proteomics target mth1598_1_140; northeast structural genomics target tt6
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
140
structure length
140
Chain Sequence
MKGFEFFDVTADAGFWAYGHDLEEVFENAALAMFEVMTDTSLVEAAEERRVEITSEDRVSLLYDWLDELLFIHDTEFILFSKFKVKIDEKDDGLHLTGTAMGEEIKEGHERRDEVKAVTFHMMEILDEDGLIKARVILDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An NMR approach to structural proteomics.
pubmed doi rcsb
molecule keywords Conserved Hypothetical Protein MTH1598
molecule tags Structural genomics, unknown function
total genus 21
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01951 Archease Archease protein family (MTH1598/TM1083)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.55.10.10 Alpha Beta 3-Layer(bab) Sandwich Archease, Possible Chaperone; Chain: A; domain 1 Archease domain 1jw3A00
1JW3A 1J5UA 4N2PA
chains in the Genus database with same CATH superfamily
1JW3A 1J5UA 4N2PA
chains in the Genus database with same CATH topology
1JW3A 1J5UA 4N2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JW3 A;  1J5U A;  4N2P A; 
#chains in the Genus database with same CATH topology
 1JW3 A;  1J5U A;  4N2P A; 
#chains in the Genus database with same CATH homology
 1JW3 A;  1J5U A;  4N2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...