The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
102
|
structure length |
102
|
Chain Sequence |
DKAYVAPEKFSSKVLTWLGKMPLFKNTEVVQKHTENIRVQDQKILQTFLHALTEKYGETAVNDALLMSRINMNKPLTQRLAVQITECVKAADEGFINLIKSK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Maintenance of an unfolded polypeptide by a cognate chaperone in bacterial type III secretion.
pubmed doi rcsb |
| molecule tags |
Chaperone
|
| source organism |
Salmonella typhimurium
|
| molecule keywords |
SicP
|
| total genus |
23
|
| structure length |
102
|
| sequence length |
102
|
| chains with identical sequence |
F
|
| ec nomenclature |
ec
3.1.3.48: Protein-tyrosine-phosphatase. |
| pdb deposition date | 2001-09-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| E | PF09119 | SicP-binding | SicP binding |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | non globular Virulence effector SptP fold | non globular Virulence effector SptP domain |
#chains in the Genus database with same CATH superfamily 1JYO E; #chains in the Genus database with same CATH topology 1JYO E; #chains in the Genus database with same CATH homology 1JYO E;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
