1KMFB

Nmr structure of human insulin mutant ile-a2-allo-ile, his-b10-asp, pro-b28-lys, lys-b29-pro, 15 structures
Total Genus 3

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
30
structure length
30
Chain Sequence
FVNQHLCGSDLVEALYLVCGERGFFYTKPT

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (17-20)TIV2 (19-22)AH1 (9-17)Updating...
connected with : NaN
molecule tags Hormone/growth factor
publication title Chiral mutagenesis of insulin's hidden receptor-binding surface: structure of an allo-isoleucine(A2) analogue.
pubmed doi rcsb
molecule keywords Insulin
total genus 3
structure length 30
sequence length 30
ec nomenclature
pdb deposition date 2001-12-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.