1KVEA

Killer toxin from halotolerant yeast
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
WSLRWRMQKSTTIAAIAGCSGAATFGGLAGGIVGCIAAGILAILQGFEVNWHNGGGGDRSNPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The novel acidophilic structure of the killer toxin from halotolerant yeast demonstrates remarkable folding similarity with a fungal killer toxin.
pubmed doi rcsb
molecule tags Toxin
molecule keywords SMK TOXIN
total genus 10
structure length 63
sequence length 63
chains with identical sequence C
ec nomenclature
pdb deposition date 1996-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.420.10 Few Secondary Structures Irregular Smk Toxin, alpha chain Smk Toxin, alpha chain 1kveA00
1KVEA 1KVDA
chains in the Genus database with same CATH superfamily
1KVEA 1KVDA
chains in the Genus database with same CATH topology
1KVEA 1KVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVE A;  1KVD A; 
#chains in the Genus database with same CATH topology
 1KVE A;  1KVD A; 
#chains in the Genus database with same CATH homology
 1KVE A;  1KVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...