The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
4
|
sequence length |
40
|
structure length |
40
|
Chain Sequence |
MTTSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A Cys3His Zinc-Binding Domain from Nup475/Tristetraproline: a Novel Fold with a Disklike Structure
pubmed doi rcsb |
| molecule tags |
Metal binding protein
|
| source organism |
Mus musculus
|
| molecule keywords |
Tristetraproline
|
| total genus |
4
|
| structure length |
40
|
| sequence length |
40
|
| ec nomenclature | |
| pdb deposition date | 2002-07-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00642 | zf-CCCH | Zinc finger C-x8-C-x5-C-x3-H type (and similar) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | CCCH zinc finger | Zinc finger, CCCH-type |
#chains in the Genus database with same CATH superfamily 2D9N A; 2CQE A; 2RHK C; 1M9O A; #chains in the Genus database with same CATH topology 2D9N A; 2CQE A; 2RHK C; 1M9O A; #chains in the Genus database with same CATH homology 2D9N A; 2CQE A; 2RHK C; 1M9O A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
