1R7DA

Nmr structure of the membrane anchor domain (1-31) of the nonstructural protein 5a (ns5a) of hepatitis c virus (ensemble of 51 structures, sample in 50% tfe)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
31
structure length
31
Chain Sequence
SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the membrane anchor domain of hepatitis C virus nonstructural protein 5A.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Genome polyprotein
total genus 7
structure length 31
sequence length 31
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01506 HCV_NS5a Hepatitis C virus non-structural 5a protein membrane anchor
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...