The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
87
|
sequence length |
272
|
structure length |
264
|
Chain Sequence |
MNKQEVILKVQECAAWWILERQSKLTKLMSETMSINPFMTPFIFDYHSLNDFDELVEAIIAKHLMTGHDTGFGKLIDEKILPRVFGAYKLDKFIHPCFDEIDHVIQRDDGRIELLSLKAGKWTIQLTMAVQLNKAFHEIINNYPGVADNIVVGVFYGNSHGLTDKYRILRGINTGANHNVIDIRDKVHVYAGKEFWSWLNNGEAETQHWVLEGIERAVKEADIKEKNKDLIEKFKEHVAKKYNEQVLNADGTAQWHKLLEMINE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
EcoO109IR
|
| publication title |
Crystal structures of type II restriction endonuclease EcoO109I and its complex with cognate DNA
pubmed doi rcsb |
| source organism |
Escherichia coli
|
| total genus |
87
|
| structure length |
264
|
| sequence length |
272
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.1.21.4: Type II site-specific deoxyribonuclease. |
| pdb deposition date | 2004-11-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF14511 | RE_EcoO109I | Type II restriction endonuclease EcoO109I |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | type ii restriction endonuclease, domain 1 | type ii restriction endonuclease, domain 1 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | type ii restriction endonuclease, domain 2 | type ii restriction endonuclease, domain 2 |
#chains in the Genus database with same CATH superfamily 1WTE A; 1WTD A; #chains in the Genus database with same CATH topology 1WTE A; 1WTD A; #chains in the Genus database with same CATH homology 1WTE A; 1WTD A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
