The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
48
|
sequence length |
217
|
structure length |
213
|
Chain Sequence |
CGRIAQKSAPEDYVEILWPNARLVAGPRYNIPPGTRPLTMHRLVDQAEALARLPWGYKPHGSSFFMINAKLETIERHGWPWKLMIGTGRILVPADGWYEWKALDSGPKPAKQPYYIHGDAPLLFAGLSAWRRGAELDEAHGFAIVTNDALGGMVDVHDRRPVALPPELAREWVDPATPVARAKEILRAGLPETAFSWYPVRQEVGSSKYQLPD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of the phage-related conserved hypothetical protein BB2244 from Bordetella bronchiseptica, Northeast Structural Genomics Target BoR24
rcsb |
| molecule keywords |
phage-related conserved hypothetical protein, BB2244
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bordetella bronchiseptica
|
| total genus |
48
|
| structure length |
213
|
| sequence length |
217
|
| ec nomenclature | |
| pdb deposition date | 2005-10-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02586 | SRAP | SOS response associated peptidase (SRAP) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | hypothetical protein yedk fold | SOS response associated peptidase-like |
#chains in the Genus database with same CATH superfamily 1ZN6 A; 5KO9 A; 2BDV A; 2F20 A; 2ICU A; #chains in the Genus database with same CATH topology 2AEG A; 1ZN6 A; 2BDV A; 2F20 A; 5KO9 A; 2ICU A; #chains in the Genus database with same CATH homology 1ZN6 A; 5KO9 A; 2BDV A; 2F20 A; 2ICU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...