The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
92
|
structure length |
92
|
Chain Sequence |
NNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINLASFAGQIQADEDQIRFYFDKTM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structures and Functional Studies of T4Mod, the Toluene 4-Monooxygenase Catalytic Effector Protein
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Pseudomonas mendocina
|
molecule keywords |
TOLUENE-4-MONOOXYGENASE SYSTEM PROTEIN D
|
total genus |
21
|
structure length |
92
|
sequence length |
92
|
chains with identical sequence |
B
|
ec nomenclature |
ec
1.14.13.-: |
pdb deposition date | 2004-12-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02406 | MmoB_DmpM | MmoB/DmpM family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Phenol Hydroxylase P2 Protein | Monooxygenase component MmoB/DmpM |
#chains in the Genus database with same CATH superfamily 3I5J E; 2BF2 A; 1G10 A; 2BF3 A; 4GAM D; 3DHH E; 3GE3 E; 3Q14 E; 3Q3M E; 2MOB A; 1G11 A; 1CKV A; 3Q3N E; 2INN L; 3Q2A E; 3I63 E; 1HQI A; 3DHI E; 3GE8 E; 2BF3 B; 3Q3O E; 2BF5 A; 2INP L; 3RI7 E; #chains in the Genus database with same CATH topology 3I5J E; 2BF2 A; 1G10 A; 2BF3 A; 4GAM D; 3DHH E; 3GE3 E; 3Q14 E; 3Q3M E; 2MOB A; 1G11 A; 1CKV A; 3Q3N E; 2INN L; 3Q2A E; 3I63 E; 1HQI A; 3DHI E; 3GE8 E; 2BF3 B; 3Q3O E; 2BF5 A; 2INP L; 3RI7 E; #chains in the Genus database with same CATH homology 3I5J E; 2BF2 A; 1G10 A; 2BF3 A; 4GAM D; 3DHH E; 3GE3 E; 3Q14 E; 3Q3M E; 2MOB A; 1G11 A; 1CKV A; 3Q3N E; 2INN L; 3Q2A E; 3I63 E; 1HQI A; 3DHI E; 3GE8 E; 2BF3 B; 3Q3O E; 2BF5 A; 2INP L; 3RI7 E;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...