The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
98
|
structure length |
98
|
Chain Sequence |
MKSSIPITEVLPRAVGSLTFDENYNLLDTSGVAKVIEKSPIAEIIRKSNAELGRLGYSVYEDAQYIGHAFKKAGHFIVYFTPKNKNREGVVPPVGITN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of hypothetical protein yst6499 from Saccharomyces cerevisiae/ Northeast Structural Genomics Consortium Target YT727/ Ontario Center for Structural Proteomics Target yst6499
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
hypothetical protein; Ynr034w-ap
|
| total genus |
17
|
| structure length |
98
|
| sequence length |
98
|
| ec nomenclature | |
| pdb deposition date | 2006-04-24 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11503 | DUF3215 | Protein of unknown function (DUF3215) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Profilin-like | YNR034W-A-like |
#chains in the Genus database with same CATH superfamily 2GRG A; 4XPM B; #chains in the Genus database with same CATH topology 2GRG A; 4XPM B; #chains in the Genus database with same CATH homology 2GRG A; 4XPM B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
