2HDIB

Crystal structure of the colicin i receptor cir from e.coli in complex with receptor binding domain of colicin ia.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
KNTPDGKTIVSPEKFPGRSSTNHSIVVSGDPRFAGTIKITTSAVIDNRANLNYLLSHSGLDYKRNILNDRNPVVTEDVEGDKKIYNAEVAEWDKLRQRLLDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of colicin I receptor bound to the R-domain of colicin Ia: implications for protein import.
pubmed doi rcsb
molecule keywords Colicin I receptor
molecule tags Protein transport,antimicrobial protein
source organism Escherichia coli
total genus 33
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11504 Colicin_Ia Colicin Ia
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.305.10 Alpha Beta 2-Layer Sandwich Colicin Ia; domain 2 Colicin Ia; domain 2 2hdiB00
1CIIA 2HDIB
chains in the Genus database with same CATH superfamily
1CIIA 2HDIB
chains in the Genus database with same CATH topology
1CIIA 2HDIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CII A;  2HDI B; 
#chains in the Genus database with same CATH topology
 1CII A;  2HDI B; 
#chains in the Genus database with same CATH homology
 1CII A;  2HDI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...