The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
103
|
structure length |
103
|
Chain Sequence |
KNTPDGKTIVSPEKFPGRSSTNHSIVVSGDPRFAGTIKITTSAVIDNRANLNYLLSHSGLDYKRNILNDRNPVVTEDVEGDKKIYNAEVAEWDKLRQRLLDAR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of colicin I receptor bound to the R-domain of colicin Ia: implications for protein import.
pubmed doi rcsb |
| molecule tags |
Protein transport,antimicrobial protein
|
| source organism |
Escherichia coli
|
| molecule keywords |
Colicin I receptor
|
| total genus |
33
|
| structure length |
103
|
| sequence length |
103
|
| ec nomenclature | |
| pdb deposition date | 2006-06-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF11504 | Colicin_Ia | Colicin Ia |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Colicin Ia; domain 2 | Colicin Ia; domain 2 |
#chains in the Genus database with same CATH superfamily 2HDI B; 1CII A; #chains in the Genus database with same CATH topology 2HDI B; 1CII A; #chains in the Genus database with same CATH homology 2HDI B; 1CII A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
