The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
104
|
structure length |
92
|
Chain Sequence |
SLSIGRTCWAIAEGYIPPETVCILNAGDEDAHVEITIYYSDKEPVGPYRLTVPARRTKHVRFNDLNDPAPIPHDTDFASVIQSNVPIVVQHT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Signaling protein
|
source organism |
Anabaena sp.
|
publication title |
Crystal structure of the anabaena sensory rhodopsin transducer.
pubmed doi rcsb |
molecule keywords |
Sensory rhodopsin transducer protein
|
total genus |
17
|
structure length |
92
|
sequence length |
104
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2006-09-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07100 | ASRT | Anabaena sensory rhodopsin transducer |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Hypothetical Protein Tm1070; Chain: A | TM1070-like |
#chains in the Genus database with same CATH superfamily 2IIA A; 2II9 A; 2II8 A; 1NC7 A; 2II7 A; #chains in the Genus database with same CATH topology 2IIA A; 2II9 A; 4H3W A; 2II8 A; 1NC7 A; 2II7 A; #chains in the Genus database with same CATH homology 2IIA A; 2II9 A; 2II8 A; 1NC7 A; 2II7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...