The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
52
|
structure length |
52
|
Chain Sequence |
VIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKHLNK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution Structure of the B. subtilis Anti-TRAP trimer and its Interaction with TRAP
rcsb |
| molecule tags |
Transcription regulator
|
| source organism |
Bacillus subtilis
|
| molecule keywords |
Tryptophan RNA-binding attenuator protein inhibitory protein
|
| total genus |
9
|
| structure length |
52
|
| sequence length |
52
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2009-09-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF15777 | Anti-TRAP | Tryptophan RNA-binding attenuator protein inhibitory protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Chaperone, DNAj Protein; Chain A | Chaperone, DNAj Protein; Chain A |
#chains in the Genus database with same CATH superfamily 3LCZ A; 2KO8 A; 2ZP9 C; 2BX9 A; 2ZP8 E; 3LD0 1; #chains in the Genus database with same CATH topology 3LCZ A; 2KO8 A; 1EXK A; 2ZP9 C; 2BX9 A; 1NLT A; 2ZP8 E; 3LD0 1; 2CTT A; #chains in the Genus database with same CATH homology 3LCZ A; 2KO8 A; 2ZP9 C; 2BX9 A; 2ZP8 E; 3LD0 1;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
