2KSLA

Structure of the insecticidal toxin taitx-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
SEPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Weaponization of a Hormone: Convergent Recruitment of Hyperglycemic Hormone into the Venom of Arthropod Predators
pubmed doi rcsb
molecule keywords U1-agatoxin-Ta1a
molecule tags Toxin
source organism Tegenaria agrestis
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2010-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.2010.20 Mainly Alpha Orthogonal Bundle Crustacean CHH/MIH/GIH neurohormone Crustacean CHH/MIH/GIH neurohormone 2kslA00
2KSLA
chains in the Genus database with same CATH superfamily
2KSLA 1J0TA
chains in the Genus database with same CATH topology
2KSLA 1J0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSL A; 
#chains in the Genus database with same CATH topology
 2KSL A;  1J0T A; 
#chains in the Genus database with same CATH homology
 2KSL A;  1J0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...