The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
40
|
structure length |
40
|
Chain Sequence |
CVATRNSCKPAAAACCDPCASCYCRFFRSACYCRVLSLNC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Loop-swapped chimeras of the agouti-related protein and the agouti signaling protein identify contacts required for melanocortin 1 receptor selectivity and antagonism.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Agouti-signaling protein
|
| total genus |
3
|
| structure length |
40
|
| sequence length |
40
|
| ec nomenclature | |
| pdb deposition date | 2010-06-14 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Agouti Related Protein; Chain A | Agouti domain |
#chains in the Genus database with same CATH superfamily 1Y7K A; 1Y7J A; 1HYK A; 2KZA A; #chains in the Genus database with same CATH topology 1Y7K A; 1Y7J A; 1HYK A; 2KZA A; #chains in the Genus database with same CATH homology 1Y7K A; 1Y7J A; 1HYK A; 2KZA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
