The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
62
|
structure length |
62
|
Chain Sequence |
MVRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
High resolution NMR structure of gpW (W protein of bacteriophage lambda) at acidic pH
rcsb |
| molecule keywords |
Head-to-tail joining protein W (GpW) from bacteriophage orig
|
| molecule tags |
Viral protein
|
| source organism |
Enterobacteria phage lambda
|
| total genus |
13
|
| structure length |
62
|
| sequence length |
62
|
| ec nomenclature | |
| pdb deposition date | 2010-11-24 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Head-to-tail joining protein W, gpW | Head-to-tail joining protein W |
#chains in the Genus database with same CATH superfamily 2L6Q A; 1HYW A; 2L6R A; #chains in the Genus database with same CATH topology 2L6Q A; 1HYW A; 2L6R A; #chains in the Genus database with same CATH homology 2L6Q A; 1HYW A; 2L6R A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...