2L6RA

High resolution nmr structure of gpw (w protein of bacteriophage lambda) at acidic ph
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
MVRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution NMR structure of gpW (W protein of bacteriophage lambda) at acidic pH
rcsb
molecule keywords Head-to-tail joining protein W (GpW) from bacteriophage orig
molecule tags Viral protein
source organism Enterobacteria phage lambda
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1580.10 Alpha Beta 2-Layer Sandwich Head-to-tail joining protein W, gpW Head-to-tail joining protein W 2l6rA00
2L6QA 1HYWA 2L6RA
chains in the Genus database with same CATH superfamily
2L6QA 1HYWA 2L6RA
chains in the Genus database with same CATH topology
2L6QA 1HYWA 2L6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6Q A;  1HYW A;  2L6R A; 
#chains in the Genus database with same CATH topology
 2L6Q A;  1HYW A;  2L6R A; 
#chains in the Genus database with same CATH homology
 2L6Q A;  1HYW A;  2L6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...