The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
71
|
structure length |
71
|
Chain Sequence |
MKTFALQGDTLDAICVRYYGRTEGVVETVLAANPGLAELGAVLPHGTAVELPDVQTAPVAETVNLWEVEHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural characterization of the phage P2 baseplate
rcsb |
| molecule keywords |
Tail protein X
|
| molecule tags |
Viral protein
|
| source organism |
Enterobacteria phage p2
|
| total genus |
11
|
| structure length |
71
|
| sequence length |
71
|
| ec nomenclature | |
| pdb deposition date | 2012-05-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05489 | Phage_tail_X | Phage Tail Protein X |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Membrane-bound Lytic Murein Transglycosylase D; Chain A | LysM domain |
#chains in the Genus database with same CATH superfamily 4A1K A; 4B9H A; 2DJP A; 5C8Q B; 5BUM A; 4A1I A; 1Y7M A; 4PXV A; 5C8O A; 2MTZ A; 3ZQD A; 2LTF A; 5K2L A; 1E0G A; 4A1J A; 4B8V A; 2MKX A; 5C8P A; 4A52 A; 2L9Y A; #chains in the Genus database with same CATH topology 4A1K A; 4B9H A; 2DJP A; 5C8Q B; 5BUM A; 4A1I A; 1Y7M A; 4PXV A; 5C8O A; 2MTZ A; 3ZQD A; 2LTF A; 5K2L A; 1E0G A; 4A1J A; 4B8V A; 2MKX A; 5C8P A; 4A52 A; 2L9Y A; #chains in the Genus database with same CATH homology 4A1K A; 4B9H A; 2DJP A; 5C8Q B; 5BUM A; 4A1I A; 1Y7M A; 4PXV A; 5C8O A; 2MTZ A; 3ZQD A; 2LTF A; 5K2L A; 1E0G A; 4A1J A; 4B8V A; 2MKX A; 5C8P A; 4A52 A; 2L9Y A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
