The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
4
|
sequence length |
125
|
structure length |
125
|
Chain Sequence |
GSKNKKEKNKGGKGGADCAEWLYGSCVANNGDCGQGMREGTCNEQTRKVKCRVPCNWKKEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQTVSVTKPCTTKVKNKPKGKKGKGKGN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and Functional Characterization of Two Zebrafish Midkine Proteins Reveals Importance of the Conserved Hinge for Heparin Binding and Embryogenesis
rcsb |
| molecule tags |
Hormone
|
| source organism |
Danio rerio
|
| molecule keywords |
Midkine-related growth factor
|
| total genus |
4
|
| structure length |
125
|
| sequence length |
125
|
| ec nomenclature | |
| pdb deposition date | 2012-06-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01091 | PTN_MK_C | PTN/MK heparin-binding protein family, C-terminal domain |
| A | PF05196 | PTN_MK_N | PTN/MK heparin-binding protein family, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Heparin-binding Growth Factor, Midkine; Chain A | Pleiotrophin/Midkine, N-terminal domain | ||
| Mainly Beta | Roll | Heparin-binding Growth Factor, Midkine; Chain A, C-terminal Domain; | Heparin-binding Growth Factor, Midkine; Chain A- C-terminal Domain |
#chains in the Genus database with same CATH superfamily 2LUU A; 1MKC A; 1MKN A; 2LUT A; #chains in the Genus database with same CATH topology 2LUU A; 1MKC A; 1MKN A; 2LUT A; #chains in the Genus database with same CATH homology 2LUU A; 1MKC A; 1MKN A; 2LUT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
