2OTL2

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 10
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 2otl200
1VQ92 3CCS2 1VQN2 3G4S2 3CCR2 3CCJ2 1VQ72 3CCE2 1KC83 1QVF1 1YJN2 1VQ82 1VQL2 3CC22 3CCL2 3OW21 1YHQ2 2QA42 1Q823 1VQ52 2QEX2 3CXC1 1KD13 1YJ92 1VQP2 1NJI3 1M1K3 3CCM2 1YJW2 2OTL2 3I552 1M903 3I562 1VQK2 1VQ62 1VQM2 3CC72 3CMA2 1W2B1 1VQO2 3CC42 3CD62 1YI22 1K733 3CCU2 1K8A3 1KQS1 1QVG1 3CCV2 1Q863 1K9M3 1N8R3 3CME2 1YIJ2 3G6E2 3G712 1VQ42 1JJ21 2OTJ2 1Q813 1S722 3CCQ2 1Q7Y3 3CPW1 1YIT2
chains in the Genus database with same CATH superfamily
1VQ92 3CCS2 1VQN2 2WSSI 3G4S2 3CCR2 3CCJ2 1VQ72 3CCE2 1KC83 1QVF1 2WPDI 1YJN2 1VQ82 3CC22 3CCL2 3OW21 1YHQ2 2XOKI 2QA42 1Q823 1VQL2 1VQ52 3ZIAI 2QEX2 3CXC1 1KD13 1E79I 1YJ92 2V7QI 1VQP2 1NJI3 3OFNI 1M1K3 3CCM2 1YJW2 2OTL2 3I552 1M903 3I562 1VQK2 1VQ62 1VQM2 3CC72 3CMA2 1W2B1 1VQO2 3CC42 3CD62 1YI22 4YXWI 1K733 3CCU2 1K8A3 1KQS1 1QVG1 3CCV2 1Q863 1K9M3 1N8R3 3CME2 1YIJ2 3G6E2 3G712 1VQ42 1JJ21 2OTJ2 1Q813 1S722 3CCQ2 2XNDI 1Q7Y3 3CPW1 1YIT2
chains in the Genus database with same CATH topology
1VQ92 3CCS2 1VQN2 3G4S2 3CCR2 3CCJ2 1VQ72 3CCE2 1KC83 1QVF1 1YJN2 1VQ82 1VQL2 3CC22 3CCL2 3OW21 1YHQ2 2QA42 1Q823 1VQ52 2QEX2 3CXC1 1KD13 1YJ92 1VQP2 1NJI3 1M1K3 3CCM2 1YJW2 2OTL2 3I552 1M903 3I562 1VQK2 1VQ62 1VQM2 3CC72 3CMA2 1W2B1 1VQO2 3CC42 3CD62 1YI22 1K733 3CCU2 1K8A3 1KQS1 1QVG1 3CCV2 1Q863 1K9M3 1N8R3 3CME2 1YIJ2 3G6E2 3G712 1VQ42 1JJ21 2OTJ2 1Q813 1S722 3CCQ2 1Q7Y3 3CPW1 1YIT2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 2;  3CCS 2;  1VQN 2;  3G4S 2;  3CCR 2;  3CCJ 2;  1VQ7 2;  3CCE 2;  1KC8 3;  1QVF 1;  1YJN 2;  1VQ8 2;  1VQL 2;  3CC2 2;  3CCL 2;  3OW2 1;  1YHQ 2;  2QA4 2;  1Q82 3;  1VQ5 2;  2QEX 2;  3CXC 1;  1KD1 3;  1YJ9 2;  1VQP 2;  1NJI 3;  1M1K 3;  3CCM 2;  1YJW 2;  2OTL 2;  3I55 2;  1M90 3;  3I56 2;  1VQK 2;  1VQ6 2;  1VQM 2;  3CC7 2;  3CMA 2;  1W2B 1;  1VQO 2;  3CC4 2;  3CD6 2;  1YI2 2;  1K73 3;  3CCU 2;  1K8A 3;  1KQS 1;  1QVG 1;  3CCV 2;  1Q86 3;  1K9M 3;  1N8R 3;  3CME 2;  1YIJ 2;  3G6E 2;  3G71 2;  1VQ4 2;  1JJ2 1;  2OTJ 2;  1Q81 3;  1S72 2;  3CCQ 2;  1Q7Y 3;  3CPW 1;  1YIT 2; 
#chains in the Genus database with same CATH topology
 1VQ9 2;  3CCS 2;  1VQN 2;  2WSS I;  3G4S 2;  3CCR 2;  3CCJ 2;  1VQ7 2;  3CCE 2;  1KC8 3;  1QVF 1;  2WPD I;  1YJN 2;  1VQ8 2;  3CC2 2;  3CCL 2;  3OW2 1;  1YHQ 2;  2XOK I;  2QA4 2;  1Q82 3;  1VQL 2;  1VQ5 2;  3ZIA I;  2QEX 2;  3CXC 1;  1KD1 3;  1E79 I;  1YJ9 2;  2V7Q I;  1VQP 2;  1NJI 3;  3OFN I;  1M1K 3;  3CCM 2;  1YJW 2;  2OTL 2;  3I55 2;  1M90 3;  3I56 2;  1VQK 2;  1VQ6 2;  1VQM 2;  3CC7 2;  3CMA 2;  1W2B 1;  1VQO 2;  3CC4 2;  3CD6 2;  1YI2 2;  4YXW I;  1K73 3;  3CCU 2;  1K8A 3;  1KQS 1;  1QVG 1;  3CCV 2;  1Q86 3;  1K9M 3;  1N8R 3;  3CME 2;  1YIJ 2;  3G6E 2;  3G71 2;  1VQ4 2;  1JJ2 1;  2OTJ 2;  1Q81 3;  1S72 2;  3CCQ 2;  2XND I;  1Q7Y 3;  3CPW 1;  1YIT 2; 
#chains in the Genus database with same CATH homology
 1VQ9 2;  3CCS 2;  1VQN 2;  3G4S 2;  3CCR 2;  3CCJ 2;  1VQ7 2;  3CCE 2;  1KC8 3;  1QVF 1;  1YJN 2;  1VQ8 2;  1VQL 2;  3CC2 2;  3CCL 2;  3OW2 1;  1YHQ 2;  2QA4 2;  1Q82 3;  1VQ5 2;  2QEX 2;  3CXC 1;  1KD1 3;  1YJ9 2;  1VQP 2;  1NJI 3;  1M1K 3;  3CCM 2;  1YJW 2;  2OTL 2;  3I55 2;  1M90 3;  3I56 2;  1VQK 2;  1VQ6 2;  1VQM 2;  3CC7 2;  3CMA 2;  1W2B 1;  1VQO 2;  3CC4 2;  3CD6 2;  1YI2 2;  1K73 3;  3CCU 2;  1K8A 3;  1KQS 1;  1QVG 1;  3CCV 2;  1Q86 3;  1K9M 3;  1N8R 3;  3CME 2;  1YIJ 2;  3G6E 2;  3G71 2;  1VQ4 2;  1JJ2 1;  2OTJ 2;  1Q81 3;  1S72 2;  3CCQ 2;  1Q7Y 3;  3CPW 1;  1YIT 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...