The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
166
|
structure length |
166
|
Chain Sequence |
IHPPKVEYFDLRDHTNTDPKGFVRHVDHYRVEPWGLYMARTSDHPQFHYLESWLLPDLGLRASIFHYHPYHQRDQDHYVDIGTFTRGDDVWKSEDHYLDLVVRTGRDTELLDVDELMEAHTTGLLDTATAEQAILTATTAIDGIAAHGHDLGRWLASIGMPIDWRG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The crystal structure of the protein of uncharacterized function, DUF402 from Rhodococcus sp. RHA1
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Rhodococcus sp.
|
molecule keywords |
Hypothetical protein DUF402
|
total genus |
47
|
structure length |
166
|
sequence length |
166
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2007-03-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04167 | DUF402 | Protein of unknown function (DUF402) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | FomD barrel-like fold | FomD-like |
#chains in the Genus database with same CATH superfamily 3CBT A; 3EXM A; 2P12 A; #chains in the Genus database with same CATH topology 3CBT A; 3EXM A; 2P12 A; #chains in the Genus database with same CATH homology 3CBT A; 3EXM A; 2P12 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...