2QA42

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 8
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 2qa4200
1VQP2 1VQM2 3CCU2 3CCQ2 1KD13 1VQN2 3G6E2 1K9M3 2QA42 3CC72 1YIJ2 3CCS2 3CPW1 1VQ72 1VQ42 1YHQ2 1Q823 1QVF1 3CCL2 1K733 3CC22 3OW21 1KQS1 3G712 1NJI3 1VQL2 3CCE2 3CCR2 1VQ92 1VQO2 1K8A3 3CC42 3I552 3G4S2 3CXC1 1W2B1 1Q7Y3 1KC83 1M903 1VQK2 1VQ82 1JJ21 1YI22 3CCJ2 1YJW2 1YIT2 1Q863 2QEX2 3CMA2 2OTL2 3CD62 1VQ62 1M1K3 2OTJ2 1S722 1YJ92 3CME2 3I562 1VQ52 1QVG1 1Q813 1N8R3 3CCM2 1YJN2 3CCV2
chains in the Genus database with same CATH superfamily
1VQP2 1VQM2 3CCU2 3CCQ2 2WSSI 1KD13 1VQN2 3G6E2 4YXWI 2QA42 1K9M3 2XNDI 3CC72 1YIJ2 3CCS2 3CPW1 1VQ72 1E79I 1YHQ2 1Q823 1VQ42 1QVF1 3ZIAI 3CCL2 1K733 3CC22 3OW21 1KQS1 3G712 1NJI3 1VQL2 3CCE2 2XOKI 3CCR2 1VQ92 1VQO2 1K8A3 3CC42 3I552 3G4S2 3CXC1 1W2B1 2V7QI 1Q7Y3 1KC83 1M903 1VQK2 1VQ82 1JJ21 1YI22 3OFNI 3CCJ2 1YJW2 1YIT2 1Q863 2WPDI 2QEX2 3CMA2 2OTL2 1VQ62 1M1K3 3CD62 1S722 2OTJ2 1YJ92 3CME2 3I562 1VQ52 1QVG1 1Q813 1N8R3 3CCM2 1YJN2 3CCV2
chains in the Genus database with same CATH topology
1VQP2 1VQM2 3CCU2 3CCQ2 1KD13 1VQN2 3G6E2 1K9M3 2QA42 3CC72 1YIJ2 3CCS2 3CPW1 1VQ72 1VQ42 1YHQ2 1Q823 1QVF1 3CCL2 1K733 3CC22 3OW21 1KQS1 3G712 1NJI3 1VQL2 3CCE2 3CCR2 1VQ92 1VQO2 1K8A3 3CC42 3I552 3G4S2 3CXC1 1W2B1 1Q7Y3 1KC83 1M903 1VQK2 1VQ82 1JJ21 1YI22 3CCJ2 1YJW2 1YIT2 1Q863 2QEX2 3CMA2 2OTL2 3CD62 1VQ62 1M1K3 2OTJ2 1S722 1YJ92 3CME2 3I562 1VQ52 1QVG1 1Q813 1N8R3 3CCM2 1YJN2 3CCV2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP 2;  1VQM 2;  3CCU 2;  3CCQ 2;  1KD1 3;  1VQN 2;  3G6E 2;  1K9M 3;  2QA4 2;  3CC7 2;  1YIJ 2;  3CCS 2;  3CPW 1;  1VQ7 2;  1VQ4 2;  1YHQ 2;  1Q82 3;  1QVF 1;  3CCL 2;  1K73 3;  3CC2 2;  3OW2 1;  1KQS 1;  3G71 2;  1NJI 3;  1VQL 2;  3CCE 2;  3CCR 2;  1VQ9 2;  1VQO 2;  1K8A 3;  3CC4 2;  3I55 2;  3G4S 2;  3CXC 1;  1W2B 1;  1Q7Y 3;  1KC8 3;  1M90 3;  1VQK 2;  1VQ8 2;  1JJ2 1;  1YI2 2;  3CCJ 2;  1YJW 2;  1YIT 2;  1Q86 3;  2QEX 2;  3CMA 2;  2OTL 2;  3CD6 2;  1VQ6 2;  1M1K 3;  2OTJ 2;  1S72 2;  1YJ9 2;  3CME 2;  3I56 2;  1VQ5 2;  1QVG 1;  1Q81 3;  1N8R 3;  3CCM 2;  1YJN 2;  3CCV 2; 
#chains in the Genus database with same CATH topology
 1VQP 2;  1VQM 2;  3CCU 2;  3CCQ 2;  2WSS I;  1KD1 3;  1VQN 2;  3G6E 2;  4YXW I;  2QA4 2;  1K9M 3;  2XND I;  3CC7 2;  1YIJ 2;  3CCS 2;  3CPW 1;  1VQ7 2;  1E79 I;  1YHQ 2;  1Q82 3;  1VQ4 2;  1QVF 1;  3ZIA I;  3CCL 2;  1K73 3;  3CC2 2;  3OW2 1;  1KQS 1;  3G71 2;  1NJI 3;  1VQL 2;  3CCE 2;  2XOK I;  3CCR 2;  1VQ9 2;  1VQO 2;  1K8A 3;  3CC4 2;  3I55 2;  3G4S 2;  3CXC 1;  1W2B 1;  2V7Q I;  1Q7Y 3;  1KC8 3;  1M90 3;  1VQK 2;  1VQ8 2;  1JJ2 1;  1YI2 2;  3OFN I;  3CCJ 2;  1YJW 2;  1YIT 2;  1Q86 3;  2WPD I;  2QEX 2;  3CMA 2;  2OTL 2;  1VQ6 2;  1M1K 3;  3CD6 2;  1S72 2;  2OTJ 2;  1YJ9 2;  3CME 2;  3I56 2;  1VQ5 2;  1QVG 1;  1Q81 3;  1N8R 3;  3CCM 2;  1YJN 2;  3CCV 2; 
#chains in the Genus database with same CATH homology
 1VQP 2;  1VQM 2;  3CCU 2;  3CCQ 2;  1KD1 3;  1VQN 2;  3G6E 2;  1K9M 3;  2QA4 2;  3CC7 2;  1YIJ 2;  3CCS 2;  3CPW 1;  1VQ7 2;  1VQ4 2;  1YHQ 2;  1Q82 3;  1QVF 1;  3CCL 2;  1K73 3;  3CC2 2;  3OW2 1;  1KQS 1;  3G71 2;  1NJI 3;  1VQL 2;  3CCE 2;  3CCR 2;  1VQ9 2;  1VQO 2;  1K8A 3;  3CC4 2;  3I55 2;  3G4S 2;  3CXC 1;  1W2B 1;  1Q7Y 3;  1KC8 3;  1M90 3;  1VQK 2;  1VQ8 2;  1JJ2 1;  1YI2 2;  3CCJ 2;  1YJW 2;  1YIT 2;  1Q86 3;  2QEX 2;  3CMA 2;  2OTL 2;  3CD6 2;  1VQ6 2;  1M1K 3;  2OTJ 2;  1S72 2;  1YJ9 2;  3CME 2;  3I56 2;  1VQ5 2;  1QVG 1;  1Q81 3;  1N8R 3;  3CCM 2;  1YJN 2;  3CCV 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...