2QA42

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 8
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 2qa4200
1YIT2 3CXC1 1Q863 3I562 3CCR2 1K733 1VQ42 1VQL2 1Q813 3CPW1 1Q823 1QVG1 3CC42 3CC72 1K8A3 3OW21 3CD62 3CCV2 1YJ92 1YIJ2 1Q7Y3 1VQ52 3CME2 1NJI3 1YHQ2 1VQK2 2OTL2 1VQ82 1VQM2 3G4S2 3G6E2 1VQ92 1YJN2 3CCM2 3CCQ2 3CCU2 1VQP2 1N8R3 1VQ62 3CMA2 2OTJ2 1QVF1 1VQO2 1S722 1K9M3 1KD13 1YJW2 3CCS2 1M903 1KC83 1JJ21 1W2B1 1M1K3 3I552 3CCL2 2QA42 3G712 3CCE2 2QEX2 1VQ72 1KQS1 3CCJ2 1VQN2 1YI22 3CC22
chains in the Genus database with same CATH superfamily
1YIT2 3CXC1 1Q863 3I562 3CCR2 1K733 2V7QI 2XOKI 1VQ42 1VQL2 1Q813 3CPW1 1Q823 3ZIAI 1QVG1 3CC42 3CC72 3OFNI 3OW21 1K8A3 3CD62 3CCV2 1YJ92 1YIJ2 4YXWI 1Q7Y3 1VQ52 3CME2 1NJI3 3CCJ2 1YHQ2 1VQK2 2OTL2 1VQ82 2WSSI 3G4S2 3G6E2 1VQM2 1VQ92 1YJN2 3CCM2 3CCQ2 3CCU2 1VQP2 1N8R3 1VQ62 3CMA2 1E79I 1QVF1 2OTJ2 1VQO2 2WPDI 1S722 1K9M3 1KD13 1YJW2 3CCS2 1M903 1KC83 1JJ21 1W2B1 1M1K3 3I552 3CCL2 2QA42 3G712 3CCE2 2QEX2 1VQ72 1KQS1 2XNDI 1VQN2 1YI22 3CC22
chains in the Genus database with same CATH topology
1YIT2 3CXC1 1Q863 3I562 3CCR2 1K733 1VQ42 1VQL2 1Q813 3CPW1 1Q823 1QVG1 3CC42 3CC72 1K8A3 3OW21 3CD62 3CCV2 1YJ92 1YIJ2 1Q7Y3 1VQ52 3CME2 1NJI3 1YHQ2 1VQK2 2OTL2 1VQ82 1VQM2 3G4S2 3G6E2 1VQ92 1YJN2 3CCM2 3CCQ2 3CCU2 1VQP2 1N8R3 1VQ62 3CMA2 2OTJ2 1QVF1 1VQO2 1S722 1K9M3 1KD13 1YJW2 3CCS2 1M903 1KC83 1JJ21 1W2B1 1M1K3 3I552 3CCL2 2QA42 3G712 3CCE2 2QEX2 1VQ72 1KQS1 3CCJ2 1VQN2 1YI22 3CC22
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT 2;  3CXC 1;  1Q86 3;  3I56 2;  3CCR 2;  1K73 3;  1VQ4 2;  1VQL 2;  1Q81 3;  3CPW 1;  1Q82 3;  1QVG 1;  3CC4 2;  3CC7 2;  1K8A 3;  3OW2 1;  3CD6 2;  3CCV 2;  1YJ9 2;  1YIJ 2;  1Q7Y 3;  1VQ5 2;  3CME 2;  1NJI 3;  1YHQ 2;  1VQK 2;  2OTL 2;  1VQ8 2;  1VQM 2;  3G4S 2;  3G6E 2;  1VQ9 2;  1YJN 2;  3CCM 2;  3CCQ 2;  3CCU 2;  1VQP 2;  1N8R 3;  1VQ6 2;  3CMA 2;  2OTJ 2;  1QVF 1;  1VQO 2;  1S72 2;  1K9M 3;  1KD1 3;  1YJW 2;  3CCS 2;  1M90 3;  1KC8 3;  1JJ2 1;  1W2B 1;  1M1K 3;  3I55 2;  3CCL 2;  2QA4 2;  3G71 2;  3CCE 2;  2QEX 2;  1VQ7 2;  1KQS 1;  3CCJ 2;  1VQN 2;  1YI2 2;  3CC2 2; 
#chains in the Genus database with same CATH topology
 1YIT 2;  3CXC 1;  1Q86 3;  3I56 2;  3CCR 2;  1K73 3;  2V7Q I;  2XOK I;  1VQ4 2;  1VQL 2;  1Q81 3;  3CPW 1;  1Q82 3;  3ZIA I;  1QVG 1;  3CC4 2;  3CC7 2;  3OFN I;  3OW2 1;  1K8A 3;  3CD6 2;  3CCV 2;  1YJ9 2;  1YIJ 2;  4YXW I;  1Q7Y 3;  1VQ5 2;  3CME 2;  1NJI 3;  3CCJ 2;  1YHQ 2;  1VQK 2;  2OTL 2;  1VQ8 2;  2WSS I;  3G4S 2;  3G6E 2;  1VQM 2;  1VQ9 2;  1YJN 2;  3CCM 2;  3CCQ 2;  3CCU 2;  1VQP 2;  1N8R 3;  1VQ6 2;  3CMA 2;  1E79 I;  1QVF 1;  2OTJ 2;  1VQO 2;  2WPD I;  1S72 2;  1K9M 3;  1KD1 3;  1YJW 2;  3CCS 2;  1M90 3;  1KC8 3;  1JJ2 1;  1W2B 1;  1M1K 3;  3I55 2;  3CCL 2;  2QA4 2;  3G71 2;  3CCE 2;  2QEX 2;  1VQ7 2;  1KQS 1;  2XND I;  1VQN 2;  1YI2 2;  3CC2 2; 
#chains in the Genus database with same CATH homology
 1YIT 2;  3CXC 1;  1Q86 3;  3I56 2;  3CCR 2;  1K73 3;  1VQ4 2;  1VQL 2;  1Q81 3;  3CPW 1;  1Q82 3;  1QVG 1;  3CC4 2;  3CC7 2;  1K8A 3;  3OW2 1;  3CD6 2;  3CCV 2;  1YJ9 2;  1YIJ 2;  1Q7Y 3;  1VQ5 2;  3CME 2;  1NJI 3;  1YHQ 2;  1VQK 2;  2OTL 2;  1VQ8 2;  1VQM 2;  3G4S 2;  3G6E 2;  1VQ9 2;  1YJN 2;  3CCM 2;  3CCQ 2;  3CCU 2;  1VQP 2;  1N8R 3;  1VQ6 2;  3CMA 2;  2OTJ 2;  1QVF 1;  1VQO 2;  1S72 2;  1K9M 3;  1KD1 3;  1YJW 2;  3CCS 2;  1M90 3;  1KC8 3;  1JJ2 1;  1W2B 1;  1M1K 3;  3I55 2;  3CCL 2;  2QA4 2;  3G71 2;  3CCE 2;  2QEX 2;  1VQ7 2;  1KQS 1;  3CCJ 2;  1VQN 2;  1YI2 2;  3CC2 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...