2RHKC

Crystal structure of influenza a ns1a protein in complex with f2f3 fragment of human cellular factor cpsf30, northeast structural genomics targets or8c and hr6309a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
HHSHMSGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMSECYFYSKFGECSNKECPFLHIDPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for suppression of a host antiviral response by influenza A virus.
pubmed doi rcsb
molecule tags Viral protein/nuclear protein
source organism Influenza a virus
molecule keywords Non-structural protein 1
total genus 9
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.1000.10 Few Secondary Structures Irregular CCCH zinc finger Zinc finger, CCCH-type 2rhkC00
1M9OA 2CQEA 2RHKC 2D9NA
chains in the Genus database with same CATH superfamily
1M9OA 2CQEA 2RHKC 2D9NA
chains in the Genus database with same CATH topology
1M9OA 2CQEA 2RHKC 2D9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9O A;  2CQE A;  2RHK C;  2D9N A; 
#chains in the Genus database with same CATH topology
 1M9O A;  2CQE A;  2RHK C;  2D9N A; 
#chains in the Genus database with same CATH homology
 1M9O A;  2CQE A;  2RHK C;  2D9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...