The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
84
|
sequence length |
354
|
structure length |
315
|
Chain Sequence |
PIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRPVSLPVAHSDARQNPFDF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
High Resolution Structures of the Adenovirus Single-Stranded DNA Binding Protein and the N512P Hinge-Region Mutant
rcsb |
| molecule keywords |
E2A DNA-BINDING PROTEIN
|
| molecule tags |
Dna binding protein
|
| source organism |
Human adenovirus 5
|
| total genus |
84
|
| structure length |
315
|
| sequence length |
354
|
| ec nomenclature | |
| pdb deposition date | 2009-02-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| X | PF02236 | Viral_DNA_bi | Viral DNA-binding protein, all alpha domain |
| X | PF03728 | Viral_DNA_Zn_bi | Viral DNA-binding protein, zinc binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Adenovirus Single-stranded Dna-binding Protein, domain 1 | Adenovirus DNA-binding, N-terminal domain | ||
| Alpha Beta | Alpha-Beta Complex | Adenovirus Single-stranded DNA-binding Protein; domain 2 | Adenovirus DNA-binding, C-terminal domain superfamily/Adenovirus DNA-binding, zinc binding domain |
#chains in the Genus database with same CATH superfamily 2WAZ X; 1ADU A; 1ANV A; 2WB0 X; 1ADV A; #chains in the Genus database with same CATH topology 2WAZ X; 1ZAT A; 2HKL A; 1ADU A; 1ANV A; 2WB0 X; 1ADV A; #chains in the Genus database with same CATH homology 2WAZ X; 1ADU A; 1ANV A; 2WB0 X; 1ADV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...