2BWMA

1.8a crystal structure of of psathyrella velutina lectin in complex with methyl 2-acetamido-1,2-dideoxy-1-seleno-beta-d-glucopyranoside
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
400
structure length
400
Chain Sequence
SVVVISQALPVPTRIPGVADLVGFGNGGVYIIRNSLLIQVVKVINNFGYDAGGWRVEKHVRLLADTTGDNQSDVVGFGENGVWISTNNGNNTFVDPPKMVLANFAYAAGGWRVEKHIRFMADLRKTGRADIVGFGDGGIYISRNNGGGQFAPAQLALNNFGYAQGWRLDRHLRFLADVTGDGLLDVVGFGENQVYIARNSGNGTFQPAQAVVNNFCIGAGGWTISAHPRVVADLTGDRKADILGFGVAGVYTSLNNGNGTFGAVNLVLKDFGVNSGWRVEKHVRCVSSLTNKKVGDIIGFGDAGVYVALNNGNGTFGPVKRVIDNFGYNQGWRVDKHPRFVVDLTGDGCADIVGFGENSVWACMNKGDGTFGPIMKLIDDMTVSKGWTLQKTVRYAANLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords PSATHYRELLA VELUTINA LECTIN PVL
publication title Beta-Propeller Crystal Structure of Psathyrella Velutina Lectin: An Integrin-Like Fungal Protein Interacting with Monosaccharides and Calcium.
pubmed doi rcsb
total genus 105
structure length 400
sequence length 400
ec nomenclature
pdb deposition date 2005-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13517 VCBS Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...