2C25A

1.8a crystal structure of psathyrella velutina lectin in complex with n-acetylneuraminic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
401
structure length
401
Chain Sequence
SVVVISQALPVPTRIPGVADLVGFGNGGVYIIRNSLLIQVVKVINNFGYDAGGWRVEKHVRLLADTTGDNQSDVVGFGENGVWISTNNGNNTFVDPPKMVLANFAYAAGGWRVEKHIRFMADLRKTGRADIVGFGDGGIYISRNNGGGQFAPAQLALNNFGYAQGWRLDRHLRFLADVTGDGLLDVVGFGENQVYIARNSGNGTFQPAQAVVNNFCIGAGGWTISAHPRVVADLTGDRKADILGFGVAGVYTSLNNGNGTFGAVNLVLKDFGVNSGWRVEKHVRCVSSLTNKKVGDIIGFGDAGVYVALNNGNGTFGPVKRVIDNFGYNQGWRVDKHPRFVVDLTGDGCADIVGFGENSVWACMNKGDGTFGPIMKLIDDMTVSKGWTLQKTVRYAANLYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beta-Propeller Crystal Structure of Psathyrella Velutina Lectin: An Integrin-Like Fungal Protein Interacting with Monosaccharides and Calcium.
pubmed doi rcsb
molecule keywords PSATHYRELLA VELUTINA LECTIN PVL
molecule tags Lectin
total genus 102
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13517 VCBS Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...