2F8VT

Structure of full length telethonin in complex with the n-terminus of titin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
MATSELSSEVSEENSERREAFWAEWKDLTLSTRPEEGSSLHEEDTQRHETYHQQGQSQVLVQRSPWLMMRMGILGRGLQEYQLPYQRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for a dimeric assembly of two titin/telethonin complexes induced by the telethonin C-terminus.
pubmed doi rcsb
molecule tags Contractile protein/contractile protein
source organism Homo sapiens
molecule keywords N2B-Titin Isoform
total genus 9
structure length 88
sequence length 88
chains with identical sequence Y
ec nomenclature
pdb deposition date 2005-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09470 Telethonin Telethonin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.160.10 Mainly Beta Single Sheet titin filament fold titin domain like 2f8vT01
1YA5T 2F8VT
chains in the Genus database with same CATH superfamily
1YA5T 2F8VT
chains in the Genus database with same CATH topology
1YA5T 2F8VT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA5 T;  2F8V T; 
#chains in the Genus database with same CATH topology
 1YA5 T;  2F8V T; 
#chains in the Genus database with same CATH homology
 1YA5 T;  2F8V T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...