2J5HA

Nmr analysis of mouse cripto cfc domain
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
39
structure length
39
Chain Sequence
KEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords TERATOCARCINOMA-DERIVED GROWTH FACTOR
publication title Solution structure of mouse Cripto CFC domain and its inactive variant Trp107Ala.
pubmed doi rcsb
total genus 1
structure length 39
sequence length 39
ec nomenclature
pdb deposition date 2006-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09443 CFC Cripto_Frl-1_Cryptic (CFC)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...