2JU4A

Nmr structure of the gamma subunit of cgmp phosphodiesterase
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
87
structure length
87
Chain Sequence
MNLEPPKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGCGDDIPGMEGCGTDITVICPWEACNHCELHELAQYGIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsically disordered gamma-subunit of cGMP phosphodiesterase encodes functionally relevant transient secondary and tertiary structure.
pubmed doi rcsb
molecule keywords Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodie
molecule tags Hydrolase
source organism Bos taurus
total genus 3
structure length 87
sequence length 87
ec nomenclature ec 3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase.
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04868 PDE6_gamma Retinal cGMP phosphodiesterase, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.1120.10 Few Secondary Structures Irregular Intrinsically disordered gamma-subunit of cGMP phosphodiesterase Retinal cGMP phosphodiesterase, gamma subunit 2ju4A00
2JU4A
chains in the Genus database with same CATH superfamily
2JU4A
chains in the Genus database with same CATH topology
2JU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU4 A; 
#chains in the Genus database with same CATH topology
 2JU4 A; 
#chains in the Genus database with same CATH homology
 2JU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...