The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
3
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
MNLEPPKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGCGDDIPGMEGCGTDITVICPWEACNHCELHELAQYGIC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Intrinsically disordered gamma-subunit of cGMP phosphodiesterase encodes functionally relevant transient secondary and tertiary structure.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Bos taurus
|
| molecule keywords |
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodie
|
| total genus |
3
|
| structure length |
87
|
| sequence length |
87
|
| ec nomenclature |
ec
3.1.4.35: 3',5'-cyclic-GMP phosphodiesterase. |
| pdb deposition date | 2007-08-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04868 | PDE6_gamma | Retinal cGMP phosphodiesterase, gamma subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Intrinsically disordered gamma-subunit of cGMP phosphodiesterase | Retinal cGMP phosphodiesterase, gamma subunit |
#chains in the Genus database with same CATH superfamily 2JU4 A; #chains in the Genus database with same CATH topology 2JU4 A; #chains in the Genus database with same CATH homology 2JU4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
