The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
5
|
sequence length |
49
|
structure length |
49
|
Chain Sequence |
LQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Tumor necrosis factor receptor superfamily member 17
|
| total genus |
5
|
| structure length |
49
|
| sequence length |
49
|
| ec nomenclature | |
| pdb deposition date | 2009-08-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF09257 | BCMA-Tall_bind | BCMA, TALL-1 binding |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Tumor necrosis factor receptor fold | Tumor necrosis factor receptor superfamily |
#chains in the Genus database with same CATH superfamily 2KN1 A; 1XUT A; #chains in the Genus database with same CATH topology 2KN1 A; 1XUT A; #chains in the Genus database with same CATH homology 2KN1 A; 1XUT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
