2LUUA

Nmr solution structure of midkine-b, mdkb
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
127
structure length
127
Chain Sequence
GSMKKKEKGKEPKADAECSEWQYGKCVPNSGDCGNGIREATCNEQTKKTKCKVPCNWKKDFGADCKYKFGRWAECDTTTGTRSRSGTLKKALFNAECQTTIKVSKPCTPKTPKPKGGEKKKGKGKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis of full-length midkine reveals novel residues important for heparin binding and zebrafish embryogenesis.
pubmed doi rcsb
molecule tags Hormone
source organism Danio rerio
molecule keywords Midkine-related growth factor Mdk2
total genus 4
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01091 PTN_MK_C PTN/MK heparin-binding protein family, C-terminal domain
A PF05196 PTN_MK_N PTN/MK heparin-binding protein family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.60.10 Mainly Beta Single Sheet Heparin-binding Growth Factor, Midkine; Chain A Pleiotrophin/Midkine, N-terminal domain 2luuA01
1MKNA 2LUTA 2LUUA
chains in the Genus database with same CATH superfamily
1MKNA 2LUTA 2LUUA
chains in the Genus database with same CATH topology
1MKNA 2LUTA 2LUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKN A;  2LUT A;  2LUU A; 
#chains in the Genus database with same CATH topology
 1MKN A;  2LUT A;  2LUU A; 
#chains in the Genus database with same CATH homology
 1MKN A;  2LUT A;  2LUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...