The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
197
|
structure length |
188
|
Chain Sequence |
TENAAPAQAPVSDRAWALFALDGKGLVPDGYVEGWKTFEEDFSPRGAELVARAWTDPFRLLLTDGTAAVAQYGYLGPQGEYIVAVEDTPTLKNVIVCSLATAWPILGLPPTWYKSFEYRARVVREPRKVLSEMGTEIASDIEIRVYDTTAETRYMVLPQRPAGTEGWSQQLQIVTKDCLIGVAIPQVP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb |
| molecule tags |
Lyase
|
| source organism |
Rhodococcus erythropolis
|
| molecule keywords |
Nitrile hydratase subunit alpha
|
| total genus |
53
|
| structure length |
188
|
| sequence length |
197
|
| ec nomenclature |
ec
4.2.1.84: Nitrile hydratase. |
| pdb deposition date | 2009-10-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02979 | NHase_alpha | Nitrile hydratase, alpha chain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Nitrile Hydratase; Chain A | Nitrile hydratase alpha /Thiocyanate hydrolase gamma |
#chains in the Genus database with same CATH superfamily 2ZPG A; 1UGS A; 3A8M A; 3QZ5 A; 3A8G A; 2DD5 C; 2ZZD C; 4FM4 A; 2AHJ A; 4OB2 A; 3WVD A; 1IRE A; 3X28 A; 2DPP A; 1UGQ A; 2ZPB A; 4OB3 A; 3X26 A; 3VYG C; 2D0Q A; 3A8O A; 2DD4 C; 2ZPE A; 3X24 A; 2DXC C; 4ZGD A; 4OB1 A; 2DXB C; 3A8L A; 2ZPI A; 4ZGE A; 1AHJ A; 2ZPF A; 3QYH A; 3WVE A; 4ZGJ A; 3QZ9 A; 3HHT A; 3A8H A; 2ZPH A; 3QYG A; 2QDY A; 1UGP A; 2CZ6 A; 1UGR A; 2CZ0 A; 3QXE A; 4OB0 A; 3X25 A; 1V29 A; 2CZ1 A; 3VYH A; 2CYZ A; 2CZ7 A; 2ZCF A; 3X20 A; #chains in the Genus database with same CATH topology 2ZPG A; 1UGS A; 3A8M A; 3QZ5 A; 3A8G A; 2DD5 C; 2ZZD C; 4FM4 A; 2AHJ A; 4OB2 A; 3WVD A; 1IRE A; 3X28 A; 2DPP A; 1UGQ A; 2ZPB A; 4OB3 A; 3X26 A; 3VYG C; 2D0Q A; 3A8O A; 2DD4 C; 2ZPE A; 3X24 A; 2DXC C; 4ZGD A; 4OB1 A; 2DXB C; 3A8L A; 2ZPI A; 4ZGE A; 1AHJ A; 2ZPF A; 3QYH A; 3WVE A; 4ZGJ A; 3QZ9 A; 3HHT A; 3A8H A; 2ZPH A; 3QYG A; 2QDY A; 1UGP A; 2CZ6 A; 1UGR A; 2CZ0 A; 3QXE A; 4OB0 A; 3X25 A; 1V29 A; 2CZ1 A; 3VYH A; 2CYZ A; 2CZ7 A; 2ZCF A; 3X20 A; #chains in the Genus database with same CATH homology 2ZPG A; 1UGS A; 3A8M A; 3QZ5 A; 3A8G A; 2DD5 C; 2ZZD C; 4FM4 A; 2AHJ A; 4OB2 A; 3WVD A; 1IRE A; 3X28 A; 2DPP A; 1UGQ A; 2ZPB A; 4OB3 A; 3X26 A; 3VYG C; 2D0Q A; 3A8O A; 2DD4 C; 2ZPE A; 3X24 A; 2DXC C; 4ZGD A; 4OB1 A; 2DXB C; 3A8L A; 2ZPI A; 4ZGE A; 1AHJ A; 2ZPF A; 3QYH A; 3WVE A; 4ZGJ A; 3QZ9 A; 3HHT A; 3A8H A; 2ZPH A; 3QYG A; 2QDY A; 1UGP A; 2CZ6 A; 1UGR A; 2CZ0 A; 3QXE A; 4OB0 A; 3X25 A; 1V29 A; 2CZ1 A; 3VYH A; 2CYZ A; 2CZ7 A; 2ZCF A; 3X20 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
