The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
43
|
structure length |
43
|
Chain Sequence |
ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb |
| molecule keywords |
Cytochrome c oxidase subunit 1
|
| molecule tags |
Oxidoreductase
|
| total genus |
10
|
| structure length |
43
|
| sequence length |
43
|
| chains with identical sequence |
Z
|
| ec nomenclature | |
| pdb deposition date | 2010-03-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| M | PF02285 | COX8 | Cytochrome oxidase c subunit VIII |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Cytochrome C Oxidase; Chain M | Cytochrome c oxidase, subunit 8 |
#chains in the Genus database with same CATH superfamily 2Y69 M; 3AG3 M; 1OCR M; 3WG7 M; 1OCZ M; 2EIK M; 3ABL M; 2EIJ M; 3AG4 M; 2EIN M; 5B1B M; 5IY5 M; 3ASN M; 2ZXW M; 2OCC M; 3ABM M; 5B3S M; 1V54 M; 2DYR M; 2EIM M; 5B1A M; 3AG2 M; 3AG1 M; 3X2Q M; 1OCO M; 1V55 M; 3ABK M; 3ASO M; 2EIL M; 2DYS M; 1OCC M; #chains in the Genus database with same CATH topology 2Y69 M; 3AG3 M; 1OCR M; 3WG7 M; 1OCZ M; 2EIK M; 3ABL M; 2EIJ M; 3AG4 M; 2EIN M; 5B1B M; 5IY5 M; 3ASN M; 2ZXW M; 1JO6 A; 2OCC M; 3ABM M; 5B3S M; 1V54 M; 2DYR M; 2EIM M; 5B1A M; 3AG2 M; 3AG1 M; 3X2Q M; 1OCO M; 1V55 M; 3ABK M; 3ASO M; 2EIL M; 2DYS M; 1OCC M; #chains in the Genus database with same CATH homology 2Y69 M; 3AG3 M; 1OCR M; 3WG7 M; 1OCZ M; 2EIK M; 3ABL M; 2EIJ M; 3AG4 M; 2EIN M; 5B1B M; 5IY5 M; 3ASN M; 2ZXW M; 2OCC M; 3ABM M; 5B3S M; 1V54 M; 2DYR M; 2EIM M; 5B1A M; 3AG2 M; 3AG1 M; 3X2Q M; 1OCO M; 1V55 M; 3ABK M; 3ASO M; 2EIL M; 2DYS M; 1OCC M;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...