3DHI | Genus

Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus	24
sequence length	103
structure length	103
Chain Sequence	MSTLADQALHNNNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINLASFAGQIQADEDQIRFYFDKTM

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__7544087519668397__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__7544087519668397__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://genus.fuw.edu.pl/view/3DHI/E/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__7544087519668397__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"7544087519668397","bgcolor":"white" }

setting document base to "https://genus.fuw.edu.pl/view/3DHI/E/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__7544087519668397__ ready

script 1 started

platformSpeed = 8

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Genus data interpretation

Chord Diagram

molecule tags	Oxidoreductase
source organism	Pseudomonas mendocina
publication title	Structural consequences of effector protein complex formation in a diiron hydroxylase. pubmed doi rcsb
molecule keywords	toluene 4-monooxygenase hydroxylase alpha subunit
total genus	24
structure length	103
sequence length	103
ec nomenclature
pdb deposition date	2008-06-17

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
E	PF02406	MmoB_DmpM	MmoB/DmpM family

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
3.90.56.10	Alpha Beta	Alpha-Beta Complex	Phenol Hydroxylase P2 Protein	Monooxygenase component MmoB/DmpM	3dhiE00

1HQIA 2BF2A 3I5JE 2MOBA 3RI7E 2BF3B 4GAMD 2INNL 3I63E 1G10A 3Q3ME 2BF5A 3Q3OE 3GE8E 3DHHE 3DHIE 3Q3NE 1CKVA 3Q2AE 1G11A 2BF3A 2INPL 3GE3E 3Q14E
chains in the Genus database with same CATH superfamily

#chains in the Genus database with same CATH superfamily
 1HQI A;  2BF2 A;  3I5J E;  2MOB A;  3RI7 E;  2BF3 B;  4GAM D;  2INN L;  3I63 E;  1G10 A;  3Q3M E;  2BF5 A;  3Q3O E;  3GE8 E;  3DHH E;  3DHI E;  3Q3N E;  1CKV A;  3Q2A E;  1G11 A;  2BF3 A;  2INP L;  3GE3 E;  3Q14 E; 
#chains in the Genus database with same CATH topology
 1HQI A;  2BF2 A;  3I5J E;  2MOB A;  3RI7 E;  2BF3 B;  4GAM D;  2INN L;  3I63 E;  1G10 A;  3Q3M E;  2BF5 A;  3Q3O E;  3GE8 E;  3DHH E;  3DHI E;  3Q3N E;  1CKV A;  3Q2A E;  1G11 A;  2BF3 A;  2INP L;  3GE3 E;  3Q14 E; 
#chains in the Genus database with same CATH homology
 1HQI A;  2BF2 A;  3I5J E;  2MOB A;  3RI7 E;  2BF3 B;  4GAM D;  2INN L;  3I63 E;  1G10 A;  3Q3M E;  2BF5 A;  3Q3O E;  3GE8 E;  3DHH E;  3DHI E;  3Q3N E;  1CKV A;  3Q2A E;  1G11 A;  2BF3 A;  2INP L;  3GE3 E;  3Q14 E;

...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

3DHIE

Total Genus

sequence length

structure length

Chain Sequence

Structure visualization

Chord Diagram

connected with : NaN

pfam database annotations