3G6E2

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 9
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 3g6e200
1YIJ2 1N8R3 3CCJ2 1YJW2 1KQS1 3CXC1 1Q813 3I552 1VQN2 1VQ62 3CMA2 1VQM2 1K733 3CCU2 3CC22 1Q863 3CCL2 1M1K3 1VQ92 1Q823 1NJI3 3I562 3CCV2 1KD13 2OTJ2 3CC42 1VQP2 1VQ72 1VQ42 2QEX2 3OW21 3G712 3CC72 1JJ21 1VQ52 1M903 1VQK2 2OTL2 1YI22 1S722 1VQ82 3G4S2 3CCE2 3CD62 1Q7Y3 2QA42 3CPW1 1VQO2 1KC83 1VQL2 1QVF1 3CME2 1YHQ2 1YIT2 3CCR2 3CCS2 3G6E2 3CCM2 1YJ92 1K8A3 1K9M3 1YJN2 1QVG1 1W2B1 3CCQ2
chains in the Genus database with same CATH superfamily
2WPDI 2XNDI 2WSSI 1YIJ2 4YXWI 1N8R3 3CCJ2 1YJW2 1KQS1 3CXC1 1Q813 3I552 1VQN2 2V7QI 1VQ62 3CMA2 1VQM2 1K733 3CCU2 3CC22 1Q863 3CCL2 1M1K3 1VQ92 1Q823 1NJI3 3I562 3CCV2 1KD13 2OTJ2 3CC42 1E79I 1VQP2 1VQ72 1VQ42 2QEX2 3OW21 3G712 3CC72 1JJ21 1VQ52 1M903 1VQK2 2OTL2 1YI22 1S722 1VQ82 3G4S2 3CCE2 3CD62 1Q7Y3 2QA42 3CPW1 1VQO2 1KC83 1VQL2 1QVF1 3CME2 1YHQ2 2XOKI 1YIT2 3CCR2 3CCS2 3G6E2 3OFNI 3CCM2 1YJ92 1K8A3 1YJN2 3ZIAI 1W2B1 3CCQ2 1QVG1 1K9M3
chains in the Genus database with same CATH topology
1YIJ2 1N8R3 3CCJ2 1YJW2 1KQS1 3CXC1 1Q813 3I552 1VQN2 1VQ62 3CMA2 1VQM2 1K733 3CCU2 3CC22 1Q863 3CCL2 1M1K3 1VQ92 1Q823 1NJI3 3I562 3CCV2 1KD13 2OTJ2 3CC42 1VQP2 1VQ72 1VQ42 2QEX2 3OW21 3G712 3CC72 1JJ21 1VQ52 1M903 1VQK2 2OTL2 1YI22 1S722 1VQ82 3G4S2 3CCE2 3CD62 1Q7Y3 2QA42 3CPW1 1VQO2 1KC83 1VQL2 1QVF1 3CME2 1YHQ2 1YIT2 3CCR2 3CCS2 3G6E2 3CCM2 1YJ92 1K8A3 1K9M3 1YJN2 1QVG1 1W2B1 3CCQ2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 2;  1N8R 3;  3CCJ 2;  1YJW 2;  1KQS 1;  3CXC 1;  1Q81 3;  3I55 2;  1VQN 2;  1VQ6 2;  3CMA 2;  1VQM 2;  1K73 3;  3CCU 2;  3CC2 2;  1Q86 3;  3CCL 2;  1M1K 3;  1VQ9 2;  1Q82 3;  1NJI 3;  3I56 2;  3CCV 2;  1KD1 3;  2OTJ 2;  3CC4 2;  1VQP 2;  1VQ7 2;  1VQ4 2;  2QEX 2;  3OW2 1;  3G71 2;  3CC7 2;  1JJ2 1;  1VQ5 2;  1M90 3;  1VQK 2;  2OTL 2;  1YI2 2;  1S72 2;  1VQ8 2;  3G4S 2;  3CCE 2;  3CD6 2;  1Q7Y 3;  2QA4 2;  3CPW 1;  1VQO 2;  1KC8 3;  1VQL 2;  1QVF 1;  3CME 2;  1YHQ 2;  1YIT 2;  3CCR 2;  3CCS 2;  3G6E 2;  3CCM 2;  1YJ9 2;  1K8A 3;  1K9M 3;  1YJN 2;  1QVG 1;  1W2B 1;  3CCQ 2; 
#chains in the Genus database with same CATH topology
 2WPD I;  2XND I;  2WSS I;  1YIJ 2;  4YXW I;  1N8R 3;  3CCJ 2;  1YJW 2;  1KQS 1;  3CXC 1;  1Q81 3;  3I55 2;  1VQN 2;  2V7Q I;  1VQ6 2;  3CMA 2;  1VQM 2;  1K73 3;  3CCU 2;  3CC2 2;  1Q86 3;  3CCL 2;  1M1K 3;  1VQ9 2;  1Q82 3;  1NJI 3;  3I56 2;  3CCV 2;  1KD1 3;  2OTJ 2;  3CC4 2;  1E79 I;  1VQP 2;  1VQ7 2;  1VQ4 2;  2QEX 2;  3OW2 1;  3G71 2;  3CC7 2;  1JJ2 1;  1VQ5 2;  1M90 3;  1VQK 2;  2OTL 2;  1YI2 2;  1S72 2;  1VQ8 2;  3G4S 2;  3CCE 2;  3CD6 2;  1Q7Y 3;  2QA4 2;  3CPW 1;  1VQO 2;  1KC8 3;  1VQL 2;  1QVF 1;  3CME 2;  1YHQ 2;  2XOK I;  1YIT 2;  3CCR 2;  3CCS 2;  3G6E 2;  3OFN I;  3CCM 2;  1YJ9 2;  1K8A 3;  1YJN 2;  3ZIA I;  1W2B 1;  3CCQ 2;  1QVG 1;  1K9M 3; 
#chains in the Genus database with same CATH homology
 1YIJ 2;  1N8R 3;  3CCJ 2;  1YJW 2;  1KQS 1;  3CXC 1;  1Q81 3;  3I55 2;  1VQN 2;  1VQ6 2;  3CMA 2;  1VQM 2;  1K73 3;  3CCU 2;  3CC2 2;  1Q86 3;  3CCL 2;  1M1K 3;  1VQ9 2;  1Q82 3;  1NJI 3;  3I56 2;  3CCV 2;  1KD1 3;  2OTJ 2;  3CC4 2;  1VQP 2;  1VQ7 2;  1VQ4 2;  2QEX 2;  3OW2 1;  3G71 2;  3CC7 2;  1JJ2 1;  1VQ5 2;  1M90 3;  1VQK 2;  2OTL 2;  1YI2 2;  1S72 2;  1VQ8 2;  3G4S 2;  3CCE 2;  3CD6 2;  1Q7Y 3;  2QA4 2;  3CPW 1;  1VQO 2;  1KC8 3;  1VQL 2;  1QVF 1;  3CME 2;  1YHQ 2;  1YIT 2;  3CCR 2;  3CCS 2;  3G6E 2;  3CCM 2;  1YJ9 2;  1K8A 3;  1K9M 3;  1YJN 2;  1QVG 1;  1W2B 1;  3CCQ 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...