3G712

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 7
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 3g71200
1W2B1 1K733 3OW21 1VQ42 3CCJ2 1M903 3CME2 3CCE2 1Q863 1NJI3 1Q7Y3 1S722 3CXC1 1VQ72 1K9M3 3CCR2 3CCM2 1Q813 3G6E2 1VQM2 1YJN2 1VQN2 1KC83 1YIJ2 1QVF1 1YHQ2 1QVG1 3CCU2 1VQO2 3G712 3CC42 1VQ92 3CCQ2 1YJ92 1VQP2 1M1K3 1YJW2 3CD62 1N8R3 1Q823 1YI22 1JJ21 2QEX2 2OTJ2 1YIT2 3CCL2 2OTL2 3CPW1 1KQS1 1VQ62 3CC72 3I552 3CMA2 3CCS2 3CC22 2QA42 1VQL2 1VQ52 1VQK2 3I562 1KD13 3G4S2 1K8A3 3CCV2 1VQ82
chains in the Genus database with same CATH superfamily
1W2B1 1K733 3OW21 3OFNI 1VQ42 3CCJ2 1E79I 1M903 3CME2 3CCE2 1Q863 1NJI3 1Q7Y3 1S722 3CXC1 1VQ72 1K9M3 3CCR2 3CCM2 1Q813 3G6E2 1VQM2 1YJN2 1VQN2 1KC83 1YIJ2 1QVF1 3ZIAI 1YHQ2 1QVG1 4YXWI 3CCU2 2WSSI 1VQO2 3G712 3CC42 1VQ92 3CCQ2 1YJ92 1VQP2 1M1K3 1YJW2 3CD62 1N8R3 1Q823 1YI22 1JJ21 2QEX2 2OTJ2 1YIT2 3CCL2 2OTL2 3CPW1 1KQS1 1VQ62 3CC72 3I552 3CMA2 2XNDI 2WPDI 3CC22 3CCS2 2XOKI 2QA42 1VQL2 2V7QI 3I562 1VQ52 1VQK2 1KD13 3G4S2 1K8A3 3CCV2 1VQ82
chains in the Genus database with same CATH topology
1W2B1 1K733 3OW21 1VQ42 3CCJ2 1M903 3CME2 3CCE2 1Q863 1NJI3 1Q7Y3 1S722 3CXC1 1VQ72 1K9M3 3CCR2 3CCM2 1Q813 3G6E2 1VQM2 1YJN2 1VQN2 1KC83 1YIJ2 1QVF1 1YHQ2 1QVG1 3CCU2 1VQO2 3G712 3CC42 1VQ92 3CCQ2 1YJ92 1VQP2 1M1K3 1YJW2 3CD62 1N8R3 1Q823 1YI22 1JJ21 2QEX2 2OTJ2 1YIT2 3CCL2 2OTL2 3CPW1 1KQS1 1VQ62 3CC72 3I552 3CMA2 3CCS2 3CC22 2QA42 1VQL2 1VQ52 1VQK2 3I562 1KD13 3G4S2 1K8A3 3CCV2 1VQ82
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B 1;  1K73 3;  3OW2 1;  1VQ4 2;  3CCJ 2;  1M90 3;  3CME 2;  3CCE 2;  1Q86 3;  1NJI 3;  1Q7Y 3;  1S72 2;  3CXC 1;  1VQ7 2;  1K9M 3;  3CCR 2;  3CCM 2;  1Q81 3;  3G6E 2;  1VQM 2;  1YJN 2;  1VQN 2;  1KC8 3;  1YIJ 2;  1QVF 1;  1YHQ 2;  1QVG 1;  3CCU 2;  1VQO 2;  3G71 2;  3CC4 2;  1VQ9 2;  3CCQ 2;  1YJ9 2;  1VQP 2;  1M1K 3;  1YJW 2;  3CD6 2;  1N8R 3;  1Q82 3;  1YI2 2;  1JJ2 1;  2QEX 2;  2OTJ 2;  1YIT 2;  3CCL 2;  2OTL 2;  3CPW 1;  1KQS 1;  1VQ6 2;  3CC7 2;  3I55 2;  3CMA 2;  3CCS 2;  3CC2 2;  2QA4 2;  1VQL 2;  1VQ5 2;  1VQK 2;  3I56 2;  1KD1 3;  3G4S 2;  1K8A 3;  3CCV 2;  1VQ8 2; 
#chains in the Genus database with same CATH topology
 1W2B 1;  1K73 3;  3OW2 1;  3OFN I;  1VQ4 2;  3CCJ 2;  1E79 I;  1M90 3;  3CME 2;  3CCE 2;  1Q86 3;  1NJI 3;  1Q7Y 3;  1S72 2;  3CXC 1;  1VQ7 2;  1K9M 3;  3CCR 2;  3CCM 2;  1Q81 3;  3G6E 2;  1VQM 2;  1YJN 2;  1VQN 2;  1KC8 3;  1YIJ 2;  1QVF 1;  3ZIA I;  1YHQ 2;  1QVG 1;  4YXW I;  3CCU 2;  2WSS I;  1VQO 2;  3G71 2;  3CC4 2;  1VQ9 2;  3CCQ 2;  1YJ9 2;  1VQP 2;  1M1K 3;  1YJW 2;  3CD6 2;  1N8R 3;  1Q82 3;  1YI2 2;  1JJ2 1;  2QEX 2;  2OTJ 2;  1YIT 2;  3CCL 2;  2OTL 2;  3CPW 1;  1KQS 1;  1VQ6 2;  3CC7 2;  3I55 2;  3CMA 2;  2XND I;  2WPD I;  3CC2 2;  3CCS 2;  2XOK I;  2QA4 2;  1VQL 2;  2V7Q I;  3I56 2;  1VQ5 2;  1VQK 2;  1KD1 3;  3G4S 2;  1K8A 3;  3CCV 2;  1VQ8 2; 
#chains in the Genus database with same CATH homology
 1W2B 1;  1K73 3;  3OW2 1;  1VQ4 2;  3CCJ 2;  1M90 3;  3CME 2;  3CCE 2;  1Q86 3;  1NJI 3;  1Q7Y 3;  1S72 2;  3CXC 1;  1VQ7 2;  1K9M 3;  3CCR 2;  3CCM 2;  1Q81 3;  3G6E 2;  1VQM 2;  1YJN 2;  1VQN 2;  1KC8 3;  1YIJ 2;  1QVF 1;  1YHQ 2;  1QVG 1;  3CCU 2;  1VQO 2;  3G71 2;  3CC4 2;  1VQ9 2;  3CCQ 2;  1YJ9 2;  1VQP 2;  1M1K 3;  1YJW 2;  3CD6 2;  1N8R 3;  1Q82 3;  1YI2 2;  1JJ2 1;  2QEX 2;  2OTJ 2;  1YIT 2;  3CCL 2;  2OTL 2;  3CPW 1;  1KQS 1;  1VQ6 2;  3CC7 2;  3I55 2;  3CMA 2;  3CCS 2;  3CC2 2;  2QA4 2;  1VQL 2;  1VQ5 2;  1VQK 2;  3I56 2;  1KD1 3;  3G4S 2;  1K8A 3;  3CCV 2;  1VQ8 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...