The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
180
|
structure length |
180
|
Chain Sequence |
KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Residue Phe112 of the human-type corrinoid adenosyltransferase (PduO) enzyme of Lactobacillus reuteri is critical to the formation of the four-coordinate Co(II) corrinoid substrate and to the activity of the enzyme.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| source organism |
Lactobacillus reuteri
|
| molecule keywords |
Cobalamin adenosyltransferase PduO-like protein
|
| total genus |
65
|
| structure length |
180
|
| sequence length |
180
|
| ec nomenclature |
ec
2.5.1.17: Corrinoid adenosyltransferase. |
| pdb deposition date | 2009-02-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01923 | Cob_adeno_trans | Cobalamin adenosyltransferase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Hypothetical Protein Ta1238; Chain: A; | Cobalamin adenosyltransferase-like |
#chains in the Genus database with same CATH superfamily 3GAI A; 5CY5 B; 2IDX A; 3GAJ A; 3KE5 A; 1WY1 A; 4NWQ A; 1NOG A; 4NWP A; 1NIG A; 3CI3 A; 2R6X A; 2ZHZ A; 3GAH A; 3CI4 A; 5CY5 A; 1RTY A; 2G2D A; 2NT8 A; 2R6T A; 2AH6 A; 2ZHY A; 3CI1 A; 1WOZ A; 3KE4 A; 1WVT A; #chains in the Genus database with same CATH topology 3GAI A; 5CY5 B; 2IDX A; 3GAJ A; 3KE5 A; 1WY1 A; 4NWQ A; 1NOG A; 4NWP A; 1NIG A; 3CI3 A; 2R6X A; 2ZHZ A; 3GAH A; 3CI4 A; 5CY5 A; 1RTY A; 2G2D A; 2NT8 A; 2R6T A; 2AH6 A; 2ZHY A; 3CI1 A; 1WOZ A; 3KE4 A; 1WVT A; #chains in the Genus database with same CATH homology 3GAI A; 5CY5 B; 2IDX A; 3GAJ A; 3KE5 A; 1WY1 A; 4NWQ A; 1NOG A; 4NWP A; 1NIG A; 3CI3 A; 2R6X A; 2ZHZ A; 3GAH A; 3CI4 A; 5CY5 A; 1RTY A; 2G2D A; 2NT8 A; 2R6T A; 2AH6 A; 2ZHY A; 3CI1 A; 1WOZ A; 3KE4 A; 1WVT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
