3I562

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
46
Chain Sequence
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDRRNHKRRHWRRNDTDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 46
sequence length 49
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00832 Ribosomal_L39 Ribosomal L39 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1620.10 Mainly Alpha Orthogonal Bundle Atp Synthase Epsilon Chain; Chain: I; Ribosomal protein L39e 3i56200
1YJ92 3CCQ2 3CC72 3CCR2 1S722 3G6E2 3G4S2 3CCS2 3CCU2 1VQM2 3G712 1VQ82 1QVG1 1M903 3CPW1 1K733 3CCV2 3CC22 3CCE2 3CCJ2 1Q7Y3 1K9M3 1Q823 1QVF1 1VQ92 3CC42 1NJI3 1N8R3 1YI22 3I552 3CME2 1YHQ2 1W2B1 3CCM2 1VQL2 1VQK2 1VQ62 3CMA2 1VQ72 1YIT2 3CD62 1KC83 3I562 1JJ21 1VQ42 1VQP2 1YIJ2 1M1K3 1YJN2 1KQS1 2OTJ2 3OW21 1Q863 1VQ52 2QA42 3CXC1 1Q813 2OTL2 2QEX2 3CCL2 1YJW2 1KD13 1K8A3 1VQO2 1VQN2
chains in the Genus database with same CATH superfamily
1YJ92 3CCQ2 2V7QI 3CC72 3CCR2 1S722 3G6E2 3G4S2 3CCS2 3CCU2 1VQM2 3G712 1VQ82 2OTJ2 1QVG1 1M903 3CPW1 1K733 3CCV2 3CC22 3CCE2 3CCJ2 1Q7Y3 1K9M3 1Q823 1QVF1 1VQ92 3CC42 1NJI3 2XNDI 1N8R3 2WSSI 1YI22 4YXWI 3CME2 3I552 3ZIAI 1YHQ2 1W2B1 3CCM2 1E79I 1VQL2 2WPDI 1VQK2 1VQ62 3CMA2 1VQ72 1YIT2 3CD62 1KC83 3I562 1JJ21 1VQ42 1VQP2 1YIJ2 1M1K3 1YJN2 2XOKI 1KQS1 3OFNI 3OW21 1Q863 2QA42 3CXC1 1Q813 1VQ52 2OTL2 2QEX2 3CCL2 1YJW2 1KD13 1K8A3 1VQO2 1VQN2
chains in the Genus database with same CATH topology
1YJ92 3CCQ2 3CC72 3CCR2 1S722 3G6E2 3G4S2 3CCS2 3CCU2 1VQM2 3G712 1VQ82 1QVG1 1M903 3CPW1 1K733 3CCV2 3CC22 3CCE2 3CCJ2 1Q7Y3 1K9M3 1Q823 1QVF1 1VQ92 3CC42 1NJI3 1N8R3 1YI22 3I552 3CME2 1YHQ2 1W2B1 3CCM2 1VQL2 1VQK2 1VQ62 3CMA2 1VQ72 1YIT2 3CD62 1KC83 3I562 1JJ21 1VQ42 1VQP2 1YIJ2 1M1K3 1YJN2 1KQS1 2OTJ2 3OW21 1Q863 1VQ52 2QA42 3CXC1 1Q813 2OTL2 2QEX2 3CCL2 1YJW2 1KD13 1K8A3 1VQO2 1VQN2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 2;  3CCQ 2;  3CC7 2;  3CCR 2;  1S72 2;  3G6E 2;  3G4S 2;  3CCS 2;  3CCU 2;  1VQM 2;  3G71 2;  1VQ8 2;  1QVG 1;  1M90 3;  3CPW 1;  1K73 3;  3CCV 2;  3CC2 2;  3CCE 2;  3CCJ 2;  1Q7Y 3;  1K9M 3;  1Q82 3;  1QVF 1;  1VQ9 2;  3CC4 2;  1NJI 3;  1N8R 3;  1YI2 2;  3I55 2;  3CME 2;  1YHQ 2;  1W2B 1;  3CCM 2;  1VQL 2;  1VQK 2;  1VQ6 2;  3CMA 2;  1VQ7 2;  1YIT 2;  3CD6 2;  1KC8 3;  3I56 2;  1JJ2 1;  1VQ4 2;  1VQP 2;  1YIJ 2;  1M1K 3;  1YJN 2;  1KQS 1;  2OTJ 2;  3OW2 1;  1Q86 3;  1VQ5 2;  2QA4 2;  3CXC 1;  1Q81 3;  2OTL 2;  2QEX 2;  3CCL 2;  1YJW 2;  1KD1 3;  1K8A 3;  1VQO 2;  1VQN 2; 
#chains in the Genus database with same CATH topology
 1YJ9 2;  3CCQ 2;  2V7Q I;  3CC7 2;  3CCR 2;  1S72 2;  3G6E 2;  3G4S 2;  3CCS 2;  3CCU 2;  1VQM 2;  3G71 2;  1VQ8 2;  2OTJ 2;  1QVG 1;  1M90 3;  3CPW 1;  1K73 3;  3CCV 2;  3CC2 2;  3CCE 2;  3CCJ 2;  1Q7Y 3;  1K9M 3;  1Q82 3;  1QVF 1;  1VQ9 2;  3CC4 2;  1NJI 3;  2XND I;  1N8R 3;  2WSS I;  1YI2 2;  4YXW I;  3CME 2;  3I55 2;  3ZIA I;  1YHQ 2;  1W2B 1;  3CCM 2;  1E79 I;  1VQL 2;  2WPD I;  1VQK 2;  1VQ6 2;  3CMA 2;  1VQ7 2;  1YIT 2;  3CD6 2;  1KC8 3;  3I56 2;  1JJ2 1;  1VQ4 2;  1VQP 2;  1YIJ 2;  1M1K 3;  1YJN 2;  2XOK I;  1KQS 1;  3OFN I;  3OW2 1;  1Q86 3;  2QA4 2;  3CXC 1;  1Q81 3;  1VQ5 2;  2OTL 2;  2QEX 2;  3CCL 2;  1YJW 2;  1KD1 3;  1K8A 3;  1VQO 2;  1VQN 2; 
#chains in the Genus database with same CATH homology
 1YJ9 2;  3CCQ 2;  3CC7 2;  3CCR 2;  1S72 2;  3G6E 2;  3G4S 2;  3CCS 2;  3CCU 2;  1VQM 2;  3G71 2;  1VQ8 2;  1QVG 1;  1M90 3;  3CPW 1;  1K73 3;  3CCV 2;  3CC2 2;  3CCE 2;  3CCJ 2;  1Q7Y 3;  1K9M 3;  1Q82 3;  1QVF 1;  1VQ9 2;  3CC4 2;  1NJI 3;  1N8R 3;  1YI2 2;  3I55 2;  3CME 2;  1YHQ 2;  1W2B 1;  3CCM 2;  1VQL 2;  1VQK 2;  1VQ6 2;  3CMA 2;  1VQ7 2;  1YIT 2;  3CD6 2;  1KC8 3;  3I56 2;  1JJ2 1;  1VQ4 2;  1VQP 2;  1YIJ 2;  1M1K 3;  1YJN 2;  1KQS 1;  2OTJ 2;  3OW2 1;  1Q86 3;  1VQ5 2;  2QA4 2;  3CXC 1;  1Q81 3;  2OTL 2;  2QEX 2;  3CCL 2;  1YJW 2;  1KD1 3;  1K8A 3;  1VQO 2;  1VQN 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...