3I63 | Genus

Total Genus 26

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus	26
sequence length	101
structure length	101
Chain Sequence	TLADQALHNNNVGPIIRAGDLVEPVIETAEIDNPGKEITVEDRRAYVRIAAEGELILTRKTLEEQLGRPFNMQELEINLASFAGQIQADEDQIRFYFDKTM

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__653462941508277__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__653462941508277__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://genus.fuw.edu.pl/view/3I63/E/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__653462941508277__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"653462941508277","bgcolor":"white" }

setting document base to "https://genus.fuw.edu.pl/view/3I63/E/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__653462941508277__ ready

script 1 started

platformSpeed = 8

Viewer cachePut cache://localLOAD_/file/5cff1d89e1d46e4518902e6f/pdb.gz

Viewer cachePut https://genus.fuw.edu.pl/file/5cff1d89e1d46e4518902e6f/pdb.gz

FileManager.getAtomSetCollectionFromFile(/file/5cff1d89e1d46e4518902e6f/pdb.gz)

loadScript /static/js/j2s/core/corezip.z.js

The Resolver thinks Pdb

loadScript /static/js/j2s/core/corebio.z.js

Time for openFile(/file/5cff1d89e1d46e4518902e6f/pdb.gz): 886 ms

reading 101 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

101 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 16 ms

Adding embedded #jmolscript: select ({0:100});backbone only;select *;

platformSpeed = 8

cartoonsFancy = true

sheetSmoothing = 1.0

traceAlpha = true

loadScript /static/js/j2s/core/corescriptcmd.z.js

specularPower = 9

ambientPercent = 20

antialiasDisplay = true

Script completed

Jmol script terminated

loadScript /static/js/j2s/J/g3d/HermiteRenderer.js

loadScript /static/js/j2s/J/renderbio/BioMeshRenderer.js

loadScript /static/js/j2s/J/render/MeshRenderer.js

loadScript /static/js/j2s/J/shape/Mesh.js

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Genus data interpretation

Chord Diagram

molecule tags	Oxidoreductase
source organism	Pseudomonas mendocina
publication title	Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase. pubmed doi rcsb
molecule keywords	Toluene-4-monooxygenase system protein A
total genus	26
structure length	101
sequence length	101
ec nomenclature
pdb deposition date	2009-07-06

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
E	PF02406	MmoB_DmpM	MmoB/DmpM family

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
3.90.56.10	Alpha Beta	Alpha-Beta Complex	Phenol Hydroxylase P2 Protein	Monooxygenase component MmoB/DmpM	3i63E00

1CKVA 2MOBA 2BF5A 3GE3E 3Q3OE 3DHHE 3GE8E 2INNL 3I5JE 2BF3A 3RI7E 3DHIE 1G10A 2BF3B 3Q14E 3Q3NE 1G11A 3I63E 4GAMD 3Q3ME 3Q2AE 2BF2A 1HQIA 2INPL
chains in the Genus database with same CATH superfamily

#chains in the Genus database with same CATH superfamily
 1CKV A;  2MOB A;  2BF5 A;  3GE3 E;  3Q3O E;  3DHH E;  3GE8 E;  2INN L;  3I5J E;  2BF3 A;  3RI7 E;  3DHI E;  1G10 A;  2BF3 B;  3Q14 E;  3Q3N E;  1G11 A;  3I63 E;  4GAM D;  3Q3M E;  3Q2A E;  2BF2 A;  1HQI A;  2INP L; 
#chains in the Genus database with same CATH topology
 1CKV A;  2MOB A;  2BF5 A;  3GE3 E;  3Q3O E;  3DHH E;  3GE8 E;  2INN L;  3I5J E;  2BF3 A;  3RI7 E;  3DHI E;  1G10 A;  2BF3 B;  3Q14 E;  3Q3N E;  1G11 A;  3I63 E;  4GAM D;  3Q3M E;  3Q2A E;  2BF2 A;  1HQI A;  2INP L; 
#chains in the Genus database with same CATH homology
 1CKV A;  2MOB A;  2BF5 A;  3GE3 E;  3Q3O E;  3DHH E;  3GE8 E;  2INN L;  3I5J E;  2BF3 A;  3RI7 E;  3DHI E;  1G10 A;  2BF3 B;  3Q14 E;  3Q3N E;  1G11 A;  3I63 E;  4GAM D;  3Q3M E;  3Q2A E;  2BF2 A;  1HQI A;  2INP L;

...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

3I63E

Total Genus

sequence length

structure length

Chain Sequence

Structure visualization

Chord Diagram

connected with : NaN

pfam database annotations