The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
148
|
structure length |
142
|
Chain Sequence |
FGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITLENVYPVPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTFKVNHFE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structures of the autoproteolytic domain from the Saccharomyces cerevisiae nuclear pore complex component, Nup145.
pubmed doi rcsb |
| molecule tags |
Protein transport, rna binding protein
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
Nucleoporin NUP145
|
| total genus |
34
|
| structure length |
142
|
| sequence length |
148
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.4.21.-: |
| pdb deposition date | 2009-10-26 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | c-terminal autoproteolytic domain of nucleoporin nup98 | Peptidase S59, nucleoporin |
#chains in the Genus database with same CATH superfamily 5E0Q B; 3TKN C; 3PBP B; 2Q5X A; 1KO6 A; 3KEP A; 3NF5 A; 5HB6 A; 5HB5 A; 2AIV A; 5CWW A; 3KES A; 2Q5Y A; #chains in the Genus database with same CATH topology 4DRF B; 5E0Q B; 3TKN C; 3PBP B; 4E6N B; 2Q5X A; 1KO6 A; 3KEP A; 3NF5 A; 5HB6 A; 4DQZ A; 2AIV A; 5HB5 A; 5CWW A; 3KES A; 2Q5Y A; #chains in the Genus database with same CATH homology 5E0Q B; 3TKN C; 3PBP B; 2Q5X A; 1KO6 A; 3KEP A; 3NF5 A; 5HB6 A; 5HB5 A; 2AIV A; 5CWW A; 3KES A; 2Q5Y A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
