The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
52
|
sequence length |
182
|
structure length |
177
|
Chain Sequence |
DAASDLKSRLDKVSSFHASFTQKVTDVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the lipoprotein localization factor, LolA
rcsb |
molecule tags |
Protein transport
|
source organism |
Escherichia coli
|
molecule keywords |
Outer-membrane lipoprotein carrier protein
|
total genus |
52
|
structure length |
177
|
sequence length |
182
|
ec nomenclature | |
pdb deposition date | 2009-11-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03548 | LolA | Outer membrane lipoprotein carrier protein LolA |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Clam | outer membrane lipoprotein receptor (LolB), chain A | Lipoprotein localisation LolA/LolB/LppX |
#chains in the Genus database with same CATH superfamily 1IWM A; 3WJT A; 3WJV A; 1IWL A; 2YZY A; 2W7Q A; 3KSN A; 2V42 A; 1IWN A; 3BK5 A; 3BUU A; 4Z48 A; 2ZPC A; 2P4B A; 1UA8 A; 2V43 A; 3WJU A; 3M4W A; 2ZPD A; 4MXT A; 4KI3 A; #chains in the Genus database with same CATH topology 2ZF4 A; 1IWM A; 4QA8 A; 3WJT A; 3WJV A; 1IWL A; 2BYO A; 3MH8 A; 2YZY A; 2W7Q A; 4EG9 A; 3KSN A; 2V42 A; 1IWN A; 3BK5 A; 3MH9 A; 3BMZ A; 4ZRA A; 3BUU A; 4Z48 A; 2ZPC A; 2P4B A; 1UA8 A; 2ZF3 A; 2V43 A; 3WJU A; 4EGD A; 3M4W A; 2ZPD A; 3MHA A; 4MXT A; 4KI3 A; #chains in the Genus database with same CATH homology 1IWM A; 3WJT A; 3WJV A; 1IWL A; 2YZY A; 2W7Q A; 3KSN A; 2V42 A; 1IWN A; 3BK5 A; 3BUU A; 4Z48 A; 2ZPC A; 2P4B A; 1UA8 A; 2V43 A; 3WJU A; 3M4W A; 2ZPD A; 4MXT A; 4KI3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...