The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
12
|
sequence length |
64
|
structure length |
61
|
Chain Sequence |
AATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLQSVETIEVEIILP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of Helicobacter pylori MinE, a cell division topological specificity factor
pubmed doi rcsb |
| molecule keywords |
Cell division topological specificity factor
|
| molecule tags |
Cell cycle
|
| source organism |
Helicobacter pylori
|
| total genus |
12
|
| structure length |
61
|
| sequence length |
64
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-11-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03776 | MinE | Septum formation topological specificity factor MinE |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Cell Cycle; Chain A | Cell division topological specificity factor MinE |
#chains in the Genus database with same CATH superfamily 1EV0 A; 2KXO A; 3MCD A; 3KU7 A; #chains in the Genus database with same CATH topology 3MCD A; 3KU7 A; 2KXO A; 1EV0 A; 2GJH A; #chains in the Genus database with same CATH homology 1EV0 A; 2KXO A; 3MCD A; 3KU7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...