The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
53
|
structure length |
53
|
Chain Sequence |
MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKHIHE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Bacillus licheniformis Anti-TRAP can assemble into two types of dodecameric particles with the same symmetry but inverted orientation of trimers.
pubmed doi rcsb |
| molecule tags |
Gene regulation
|
| source organism |
Bacillus licheniformis
|
| molecule keywords |
Inhibitor of TRAP, regulated by T-BOX (Trp) sequence RtpA
|
| total genus |
11
|
| structure length |
53
|
| sequence length |
53
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2010-01-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF15777 | Anti-TRAP | Tryptophan RNA-binding attenuator protein inhibitory protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Chaperone, DNAj Protein; Chain A | Chaperone, DNAj Protein; Chain A |
#chains in the Genus database with same CATH superfamily 2ZP9 C; 2KO8 A; 2BX9 A; 3LD0 1; 3LCZ A; 2ZP8 E; #chains in the Genus database with same CATH topology 2ZP9 C; 2KO8 A; 1NLT A; 2BX9 A; 2CTT A; 1EXK A; 3LD0 1; 3LCZ A; 2ZP8 E; #chains in the Genus database with same CATH homology 2ZP9 C; 2KO8 A; 2BX9 A; 3LD0 1; 3LCZ A; 2ZP8 E;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
